Conserved Protein Domain Family
cpxP

?
PRK12751: cpxP 
periplasmic stress adaptor protein CpxP; Reviewed
Links
?
Statistics
?
PSSM-Id: 171704
View PSSM: PRK12751
Aligned: 13 rows
Threshold Bit Score: 233.117
Threshold Setting Gi: 123440487
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
51594429    1 MRKVTTLVMASMFVLGSSAAFAADNTKVTEGY-HGDGKMMMNKKGDRGHHNMFDGINLTEQQRQQMRDLMRQSHQSQPRL 79 
186893416   1 MRKVTTLVMASMFVLGSSAAFAADNTKVTEGY-HGDGKMMMNKKGDRGHHNMFDGINLTEQQRQQMRDLMRQSHQSQPRL 79 
108809459   1 MRKVTTLVMASMFVLGSSAAFAADNTKVTEGY-HGDGKMMMNKKGDRGHHNMFDGINLTEQQRQQMRDLMRQSHQSQPRL 79 
108813936   1 MRKVTTLVMASMFVLGSSAAFAADNTKVTEGY-HGDGKMMMNKKGDRGHHNMFDGINLTEQQRQQMRDLMRQSHQSQPRL 79 
294502178   1 MRKVTTLVMASMFVLGSSAAFAADNTKVTEGY-HGDGKMMMNKKGDRGHHNMFDGINLTEQQRQQMRDLMRQSHQSQPRL 79 
218927294   1 MRKVTTLVMASMFVLGSSAAFAADNTKVTEGY-HGDGKMMMNKKGDRGHHNMFDGINLTEQQRQQMRDLMRQSHQSQPRL 79 
170026338   1 MRKVTTLVMASMFVLGSSAAFAADNTKVTEGY-HGDGKMMMNKKGDRGHHNMFDGINLTEQQRQQMRDLMRQSHQSQPRL 79 
162420508   1 MRKVTTLVMASMFVLGSSAAFAADNTKVTEGY-HGDGKMMMNKKGDRGHHNMFDGINLTEQQRQQMRDLMRQSHQSQPRL 79 
153950411   1 MRKVTTLVMASMFVLGSSAAFAADNTKVTEGY-HGDGKMMMNKKGDRGHHNMFDGINLTEQQRQQMRDLMRQSHQSQPRL 79 
45439939    1 MRKVTTLVMASMFVLGSSAAFAADNTKVTEGY-HGDGKMMMNKKGDRGHHNMFDGINLTEQQRQQMRDLMRQSHQSQPRL 79 
22123987    1 MRKVTTLVMASMFVLGSSAAFAADNTKVTEGY-HGDGKMMMNKKGDRGHHNMFDGINLTEQQRQQMRDLMRQSHQSQPRL 79 
123440487   1 --------MASMLVIGSQAAFAADKTGATDGWcHGDGA-MMNKKDGRGHHNMFDGLNLTEQQRQQMRDLMRQSRQDQPRV 71 
145601071   1 MRKVTTLVMASMFVLGSSAAFAADNTKVTEGY-HGDGKMMMNKKGDRGHHNMFDGINLTEQQRQQMRDLMRQSHQSQPRL 79 
51594429   80 DLEDHEAMHKLITADKFDEAAVRAQAEKMSQNQIERHVEMAKVRNQMYNLLTPEQKEALNKKHQERIEKLQQKPAAQPSS 159
186893416  80 DLEDHEAMHKLITADKFDEAAVRAQAEKMSQNQIERHVEMAKVRNQMYNLLTPEQKEALNKKHQERIEKLQQKPAAQPSS 159
108809459  80 DLEDREAMHKLITADKFDEAAVRAQAEKMSQNQIERHVEMAKVRNQMYNLLTPEQKEALNKKHQERIEKLQQKPAAQPSS 159
108813936  80 DLEDREAMHKLITADKFDEAAVRAQAEKMSQNQIERHVEMAKVRNQMYNLLTPEQKEALNKKHQERIEKLQQKPAAQPSS 159
294502178  80 DLEDREAMHKLITADKFDEAAVRAQAEKMSQNQIERHVEMAKVRNQMYNLLTPEQKEALNKKHQERIEKLQQKPAAQPSS 159
218927294  80 DLEDREAMHKLITADKFDEAAVRAQAEKMSQNQIERHVEMAKVRNQMYNLLTPEQKEALNKKHQERIEKLQQKPAAQPSS 159
170026338  80 DLEDREAMHKLITADKFDEAAVRAQAEKMSQNQIERHVEMAKVRNQMYNLLTPEQKEALNKKHQERIEKLQQKPAAQPSS 159
162420508  80 DLEDREAMHKLITADKFDEAAVRAQAEKMSQNQIERHVEMAKVRNQMYNLLTPEQKEALNKKHQERIEKLQQKPAAQPSS 159
153950411  80 DLEDREAMHKLITADKFDEAAVRAQAEKMSQNQIERHVEMAKVRNQMYNLLTPEQKEALNKKHQERIEKLQQKPAAQPSS 159
45439939   80 DLEDREAMHKLITADKFDEAAVRAQAEKMSQNQIERHVEMAKVRNQMYNLLTPEQKEALNKKHQERIEKLQQKPAAQPSS 159
22123987   80 DLEDREAMHKLITADKFDEAAVRAQAEKMSQNQIERHVEMAKVRNQMYNLLTPEQKEALNKKHQERIEKLQQKPAAQPSS 159
123440487  72 DLADREAMHKLITADKFDEAAVRAQAEKMSKDQIDRQVEMAKVRNQMFNLLTPEQKAALNQKHQQRIEKMQQAPAAQPSS 151
145601071  80 DLEDREAMHKLITADKFDEAAVSAQAEKMSQNQIERHVEMAKVRNQMYNLLTPEQKEALNKKHQERIEKLQQKPAAQPSS 159
51594429  160 AQK 162
186893416 160 AQK 162
108809459 160 AQK 162
108813936 160 AQK 162
294502178 160 AQK 162
218927294 160 AQK 162
170026338 160 AQK 162
162420508 160 AQK 162
153950411 160 AQK 162
45439939  160 AQK 162
22123987  160 AQK 162
123440487 152 AQK 154
145601071 160 AQK 162
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap