Conserved Protein Domain Family
flgL

?
PRK12718: flgL 
flagellar hook-associated protein FlgL; Provisional
Statistics
?
PSSM-Id: 79176
View PSSM: PRK12718
Aligned: 3 rows
Threshold Bit Score: 945.009
Threshold Setting Gi: 33596146
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
33592486   1 MRLSTALIYQNGLNGVLNQEAAMARLQEQLSSGRRVLTPADDPLAAALAINVSQTSSMNSNYDANRKQAEQALGAQTNTL 80 
33596146   1 MRLSTALIYQNGLNGVLNQEAAMARLQEQLSSGRRVLTPADDPLAAALAVNVSQTSSMNSNYDANRKQAEQALGAQTNTL 80 
33601548   1 MRLSTALIYQNGLNGVLNQEAAMARLQEQLSSGRRVLTPADDPLAAALAVNVSQTSSMNSNYDANRKQAEQALGAQTNTL 80 
33592486  81 QSVVKNMQEMLKRVVEAGNGTMSDADRQALVIALKGAREELVGLANATDGNGQYLFSGYKGFTQPYSFDAATGKVTYNGD 160
33596146  81 QSVVKNMQEMLKRVVEAGNGTMSDADRQALVIALKGAREELVGLANATDGNGQYLFSGYKGFTQPYSFDAATGKVTYNGD 160
33601548  81 QSVVKNMQEMLKRVVEAGNGTMSDADRQALVIALKGAREELVGLANATDGNGQYLFSGYKGFTQPYSFDAATGKVTYNGD 160
33592486 161 LGQRGIQVDQSRLMSGGDVGSDIFNSVTSGTLAYIADAGAGNTGTGQYSAVSFDGPRAGNYVGRDFRIEFTRDAVTDELQ 240
33596146 161 LGQRGIQVDQSRLMSGGDVGSDIFNSVTSGTLAYIADAGAGNAGTGQYSAVSFDGPRAGNYVGRDFRIEFTRDAVTDELQ 240
33601548 161 LGQRGIQVDQSRLMSGGDVGSDIFNSVTSGTLAYIADAGAGNAGTGQYSAVSFDGPRAGNYVGRDFRIEFTRDAVTDELQ 240
33592486 241 YSVLSDPPVVPPEQPLPANMPYSEGSVIDMNGVSIKLSGQPEAGDVFTVETPKSWKMGVQGDAANTGSATLTPVSLPDGL 320
33596146 241 YSVLSDPPVVPPEQPLPANMPYSEGSVIDMNGVSIKLSGQPEAGDVFTVETPKSWKMGVQGDAANTGSATLTPVSLPDGL 320
33601548 241 YSVLSDPPVVPPEQPLPANMPYSEGSVIDMNGVSIKLSGQPEAGDVFTVETPKSWKMGVQGDAANTGSATLTPVSLPDGL 320
33592486 321 TGKNLSVAFLDDGAGGLLYSVTSTPPDPSLPANVPVKPGDVIDIGGLKVKVDGQPAAGDTYAVTTPKSANVDVFDTLNDL 400
33596146 321 TGKNLSVAFLDDGAGGLLYSVTSTPPDPSLPANVPVKPGDVIDIGGLKVKVDGQPAAGDTYAVTTPKSANVDVFDTLNDL 400
33601548 321 TGKNLSVAFLDDGAGGLLYSVTSTPPDPSLPANVPVKPGDVIDIGGLKVKVDGQPAAGDTYAVTTPKSANVDVFDTLNDL 400
33592486 401 IGALDTPISGDPQAAAALANTLATANKKLNLSLDNVLTVQASVGARLNELEALGNTGAQKVLSYVKQLSDLEDVNIYQAT 480
33596146 401 IGALDTPISGDPQAAAALANTLATANKKLNLSLDNVLTVQASVGARLNELEALGNTGAQKGLSYVKQLSDLEDVNIYQAT 480
33601548 401 IGALDTPISGDPQAAAALANTLATANKKLNLSLDNVLTVQASVGARLNELEALGNTGAQKGLSYVKQLSDLEDVNIYQAT 480
33592486 481 SDLLLRQVALQAASLALQRIQGNSLFSMGR 510
33596146 481 SDLLLRQVALQAASLALQRIQGNSLFSMGR 510
33601548 481 SDLLLRQVALQAASLALQRIQGNSLFSMGR 510
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap