Conserved Protein Domain Family
flgL

?
PRK12717: flgL 
flagellar hook-associated protein 3
Statistics
?
PSSM-Id: 171679
View PSSM: PRK12717
Aligned: 13 rows
Threshold Bit Score: 691.482
Threshold Setting Gi: 146281778
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
146307862   3 MRISSIQAFNNGVSGLGRNYSNLIRTQEQISSGNRILTPADDPVASVRLLQLEQQQAVLKQYSDNLTAAKNSLTQEETTL 82 
77457734    1 MRISTAQYYATQAAQYQRNYSKTVATANEASSLQRINTAADDPIGAGRLLKLGQQAAMLEQYKGNIDTTKSSLTVQESTL 80 
229591864   1 MRISTQQYFDTSAAKYQNNYSGVVQAQEQASSGVRVQTAGDDPVAAQRLLMLQQQKDMLAQFSGNISNIQSSLTNEESVL 80 
70729011    1 MRISTSQFYESSATNYQKNFSKVVQSSEEASSLVRVKTAADDPVGAARLLQLGQQASLLDQYKTNTNSIKASLGQTESVM 80 
167034936   1 MRISTAQFYEASASSYSKNFSSMNKTNDQITSGIRIQTAADDPVGAARLLLLQQQQALLDQYSGNINTVSNSLLQEESVL 80 
26991069    1 MRISTAQFYETSATSYSQNYSNLAKITEQVTSKSRIQSAGDDPVGAARLLVLQQQSALLEQYSGNMTTVKNALLQEESVL 80 
148546714   1 MRISTSQFYNSNSANYQRSFSNLDKTRQEASDGIRVRRGADDPVGAARLLQLQQQQNMLDQYTRNVTNVRNALGTAESTL 80 
170722884   1 MRISTAQFYQTSAANYQRNYSNLIKTNEEASSFVRVNTAADDPVGAARLLQLGNQADMLAQYKTNATNITNSLNQTETTL 80 
146281778   1 MRLSTSLIYSSSISSYQKGYANIVKTQQQISSGERIQTPADDPVGAARLLQLEQQQALLTQYQGNLTTATNSLSQEEGIL 80 
71733470    1 MRISTTQFYESTNTNYQRTYSNVLKTSEEVSSGIKLNTASDDPVGAARVLQLAQQNSMLTQYASNIGTINTNIVNSETAL 80 
66046699    1 MRISTTQFFESTNTNYQRNYSNLNKTSEEVSSGIKLNTAGDDPVGAARVLQLAQQNSMLTQYETNIGTINTNVVTTETTL 80 
28869149    1 MRISTTQFFESTNANYQRNYANVIKTGDEVTSGIKLNTASDDPVGAARVLQLAQQNSMLTQYASNIGTINTNIVNSETAL 80 
104782835   1 MRISTSQFYNTSSANYQRGLANTVKSQEQSSDGIRVRTAADDPVGAARLLQLEQQQNMLDQYKGNITNVRNALGTSEATL 80 
146307862  83 NSVVTVMQRVRELAVRAGGGSLSAEDRNSIAKELSEREAELLNLMNSRNARGEYLFAGNLGKTEPFVRNPDGTYSYFGDE 162
77457734   81 TSITTALARAKEIGLAANNGIATDTDRKAYAAELTQIQQQVLGLMNSKDANGNYLFSGSKTDTAPYSQNADGTYTYNGDQ 160
229591864  81 TAISATIQAASQLALKAG-GVTSDADRKSISVEVGALEDQLLGLLNSKDAAGNYLFSGSKTETPPYSRNIDGTYNYQGDE 159
70729011   81 TSINNVLARAKELASGAGNAGYTDADRQANASELGQIEEQLLSLMNSQDENGKYIFGGSKDDVPPFSRNSDGTYSYNGDQ 160
167034936  81 STINDAMQRASELAIRAGGAGVTDSDRTAISTELKEIEANIFGLLNSRDANGDYMFGGSKSTTPPYVRNSDGTYSYHGDQ 160
26991069   81 STINDALQRASELAIQAGNGGLSDADRTSIASEIKEIEANVFGLLNSRDANGDYMFGGSKSSTPPYVRNADGTYSYQGDQ 160
148546714  81 NAIGTILQRVNELAISSGNAGFTDADRKANATELASLEDQLFSLMNSKDESGAYLFSGSKGDKPPYVRNADGTYTYQGDQ 160
170722884  81 NSINTILTRVNELAIESGNAGYTDTERKAKAAELGQLEDQLLSLMNSRDENGQYLFAGSSTDTAPFVRNADGTYSYQGDQ 160
146281778  81 NSINNLLQKARELAVEAGSGALSDEDRSSIASELEQIENQLYALMNSKDANGQYLFAGSSSGTQPYVKNPDGTYSYQGNQ 160
71733470   81 TSIVDTMQTAREVIVSAGNGAYTDSDRLAKAAELKQYQSQLLGLMNSQDSNGQYIFAGSKSSAPPYAQNADGTYSYSGDQ 160
66046699   81 TSIIDTMQAAREQIVSAGSGAFTDSDRLAKASALKQYQSQILGLMNSQDPNGQYIFSGSKASTPPYAQNADGSYSYKGDQ 160
28869149   81 TSIVDTMQAAREVVVSAGNGAYTDSDRLAKAAELKQYQSQILGLMNSQDANGQYIFAGSKSSAPPYAQNADGTYSYSGDQ 160
104782835  81 NSIGAVLQRVNELAVTSGNAGFTDADRKANASELAALEEQLFSLMNSKDENGKYLFSGSKGDTQPYVRNTDGSYSYQGDQ 160
146307862 163 GQRTLQVASSTNVAINDNGKRLFESVTNANRvanangvNNPALPSPPLpattipavpaNEQRVFISPGLVEDNRAFNADF 242
77457734  161 TQINLGIGDGLSVATNTTGWDAFQQTINTAR-------TQTSMTAPAV----------DDGRVVLTNGIVGTAATYNAKF 223
229591864 160 NELSLQVSETLTVRAGDTGKTILEGAANNSR-------TQTKYTTPAPvppattpsqvDDNKVAISAGLVTSGVDYNKSF 232
70729011  161 SSLQLPVGDTMMMAANSTGWDVFQQALNTSR-------SQVTMTAPAV----------DDGRISLSNGQVANNGAYNSQF 223
167034936 161 TQLSLQVSDTLNLATNDTGFSIFDSASNKSR-------TQSTLLVPAT----------DDGVVGVSSGLMTSSTSYNNSF 223
26991069  161 TQLSLQVSDTLRLATNDTGYSIFDQATNNSR-------TQSSLVAPSP----------DDGKVLLSGGLLTSATTYGNQF 223
148546714 161 GKLNLQVGDMLTLAANETGYDAFEQALNTSR-------SETSLVSPAT----------DDGRVNLSNGQVSGSATYNDRF 223
170722884 161 TQLELQVGDMLKMAGNSSGYSVFEQALNTSR-------TETSLSSPAV----------DDGRVKLSNGQVSGSVTYNDRF 223
146281778 161 NSLSLQVSGSMLLSVNDSGWSVFENVVNAGR-------TTSALATNPNa--------dGEQRVFLSAGLVVNDKTYDQQF 225
71733470  161 TSVNLAIGDGLVLPSNTTGYEAFEQAVNTTR-------TSSTLLSPAT----------DDGKVGLTGGQVTSTSAYNSGY 223
66046699  161 TSVNLAVGDGLVMASNTTGFEAFEQSVNTTR-------TSATRLSPAT----------DDGKIGLSGGLVTSTPTYNASY 223
28869149  161 TSVNLAIGDGLVLPSNTTGHEAFEQAVNTTR-------TSSTLLSPAT----------DDGKVGLTGGQVKSTSAYNAGY 223
104782835 161 SQLKLQVGDMLSLAANETGYDAFEQALNTSR-------SQTKLTSPAV----------DDGRVSLSNGQVSGSVAYNDRF 223
146307862 243 RGGEPYSLAFVSGTEFRIYDASGADVTSEIPGGGKIDPLVNGGNVINFRGMRFQLDVVLKQgdnelnldslladiqpPAT 322
77457734  224 TAGQPYTVDFISSTQIKITDALGNDVTTEASQNGAITNSNGANQTVSFRGVDLKLNINLKP----------------GDT 287
229591864 233 ADGQPYKLTFTSSTQYVVTDKNNNDITSQLPGNGTFDSTKEGSASVNLRGVKFDITVDLTDk--------------aTGP 298
70729011  224 RSGEPYTVSFVSGTQLKIVDGSGNDVTAEASKGGVF--GTAPNQTVSFRGVDLSLNVNLK-----------------SGD 284
167034936 224 TAGQPYKLTFTSATQYTITDANGRDVTSETPTNGTFDSKTEGANRIALRGVEFEITVTLE-----------------EGA 286
26991069  224 AAGQPYSVTFTSATEYSVRDAAGNDITNETAGKGKFDVNTEGGKMISLRGVDFEINLNLA-----------------EGD 286
148546714 224 RSGEPYTIEFTSSTQFKITDAEGKDVTLEASQGGTFDPNGK-NTTINFRGVDLRLDITLQEg---------------DAA 287
170722884 224 RSGQPYTVTMLSSTEFSITDSLGNDVTAEATQGGKFDPDTVGGSMISFRGVDMRLNINLQ-----------------DGD 286
146281778 226 RAGSPYTLELVSGSEFVIRDKDGTDVTAEVSGGGAFDPEAIDGTTITFRGITLELDAQALSs--------------dSSG 291
71733470  224 QAGEPYTMTFLSGTQFKITDASGTDVTTDASTAGKFSYGSFADQTFTFRGVELTMNINLSAae------------saTPA 291
66046699  224 QGGEPYTLTFLSGTQFKITDASGTDVSSDTSSGGKFSHGSFDAQTFTFRGVEMTLNVNLPAad------------rvSDA 291
28869149  224 QAGEPYTMTFLSGTQFKITDATGTDVTTDASSAGKFNYASFSDQTFTFRGVELTMNVNLSAae------------saTAA 291
104782835 224 RSGEPYSVQFTSSTQYKILDASGNDVTLEASQGGNFDPKGV-NTSVSFRGVDLRLKIDFKPg---------------DEA 287
146307862 323 AGSPGIGTHSFTLQSAPTEFAVTRASTNGSAAVVA----GGNIVNQNVFDSQFP-TSGVVLRF--TDDSNYEVFAQPVGP 395
77457734  288 NPDAVIAGHSFQLSATPDSFTSVRSPGNPSTAVIT----GSNVTNQAAYNGAFPsGGGAVLKF--TSATAFDLYAAPVTA 361
229591864 299 DADAMVKGREFSLSAKPDVFNVSRTASNTSATQLT----NATVSSPAKYASTFPaNSGVVIKFsdTDPTAFQVFTQPYSA 374
70729011  285 DANAVLPGHTFTLGSKPDTFNVARSPGNPSMTQVS----NTSITDPVAYNSTFP-SGSAILKF--TSATNFDLYAAPLTA 357
167034936 287 DADAAVAGREFSLEARPDSFNATRNGNNTSSAQIT----SSSVTDEAAYRSTFP-SNGAVIKF--TGPGAYELYAQPLTA 359
26991069  287 DADAVVAGHVFTLEAKPDTLTATRSAGNPSTAQVT----GTSVTDPEAYRSTFP-SNGAVIRF--TSDTEYSLYAQPYSA 359
148546714 288 DPDAAIAGHVFSLSSKADEISGTRSAGNSSSAQVT----GATITDAQKYKSAFP--EGAVLKF--TSATEFELYASPVSA 359
170722884 287 VPDAAVAGHTFTLQSKPDTITATRSPGNPSSAQVS----SISITDPAQYKAMFP-NGGAVIKF--TSATDFELYAQPLTA 359
146281778 292 DYDALLTGYSFEFGSTADTFAISRTSSNTSTAQLS----GGTITDTAAYNAAFP-DSGVTFKF--TSATDYEVFLQPLTA 364
71733470  292 TAATALTNRSYELASTPDTVSASRSPGNTSAATISssavGNTTADRTAFNNTFP-PNGAILKF--TSATAYDLYASPVTS 368
66046699  292 TADAALANRSYQLASTPDSVSTARSAGNTSTATVSssavGNTAADRTAFNNTFP-TEGAILKF--TSPTDYDLYAAPLTS 368
28869149  292 TAATALTNRSYELASTPDTVSASRSPGNTSAATISssavGNTTADRTAFNNTFP-PNGAILKF--TSATAYDLYASPVTS 368
104782835 288 NPDAAIAGHTFSLQSKPDTITGSRSPGNGSTTQVT----GASITNQAQYNASFP-GGGAVLKF--TSPTDFELYSAPMSA 360
146307862 396 NSPVLTTGTV-TGpypASFTVYGAEFTLSGPASagGGDQFGVQPQFQEQRSILNTISRLRQALESSPTS-PAGNLAVRNE 473
77457734  362 DSKPVSSGTV-VG---GNATAAGVTFAIGGTPA--AGDQFSIQSNNHQTQNVLDTLGQMVTALNTPIDGdPVAKQKFQGA 435
229591864 375 NSKAIDSGVIdTTttpNSITAAGVTFGLSGTPN--VGDQFSVGASTQKTQSALDTLSQLRKALEQPADGiPGARIKLQDA 452
70729011  358 DSKPVSSGVVgPG---NVATAAGVSFTLTGAPSpaANDQFSVSVNTHETQNILDTVSQLKNALNTPTAGnTLATQKQLAD 434
167034936 360 DSKAIATGTF-TA---PSLTVAGVTYQVAGSPE--AGDQFAVTANTHQNQNVLETISQLRAALDTPVTG-AGSANALKDA 432
26991069  360 DSKPIGSGTVgAG---NAVTVAGVTYQFDSAPK--QGDQFSVNANTHRTQNVLDTLGQLRSALEKPLDT-PEAQAALKTA 433
148546714 360 DSKPISKGTL-SG---NTATAMGVEFTLSDTPS--AGDSFGIKVDTHQTQNVLDTISQLRAALATPVDNdPAARQSFLAS 433
170722884 360 DSRPVASGAM-TG---NVASAAGVDFTFTSTPAqqSGDQYVVNVDNHQTQNVLDTVAQLRTALSKPIDGdNAAYQQLRAD 435
146281778 365 TSTAIGSGSL-TG---STLSFAGVSYDLSSAPA--AGDSFSVKANSAETSSILDTIATLRAALQEPIASdTEAQLALRDS 438
71733470  369 SSKPVSSGTL-TG---STANASGVNFTVSGTPA--AGDQFVVESGTHQTENILNTLTAAIKALSTPTDGnLVASQKLDAA 442
66046699  369 SSKPVSSGTM-TG---STANASGVNFNISGTPA--AGDQFIVESGTHQTENILNTLTAAIKALSTPTDGnLVASQNMTAA 442
28869149  369 SSKPVSSGTL-TG---STANASGVNFTVSGTPA--AGDQFVVESGTHQTENILNTLTAAIKALSTPTDGnLVASQKLDAA 442
104782835 361 NSRPISTGTL-SG---TTATASGVSFELSGAPA--AGDSFGVQVDTHQTQNILQTISQLRTALSVPMDKdPAARQNFLAS 434
146307862 474 VAIALKNLDNGMGSVLEVQTEIGARLNLIETTGIDNEDVTLVNKSVQAELRELDYAEALSRLSFQTIILEAAQQSYVKIA 553
77457734  436 MESALGNIESAANQIGSAVTSIGARGQSLDEQTTTNETLIQANTTTQGSIRDSDPAEVMTRLTLQQTMLQASQLAFSKIS 515
229591864 453 LNSAVSNLTSSSDQVDNVRGSIGARQNALTVQSSENESVGLANKTTMSALANIDMGEAAINLTLQQTMLEASQLAFVKIS 532
70729011  435 LASGMANLASGIDQLSIGISSVGGRGSALDTQTEINESLAAANTKTRSAISDSDPAEVMTRLTLQQTMLQASQLAFSKIA 514
167034936 433 AASAIANLASAREQVDITRGSIGARGNSLEIQRQENTSLGLANKTTQNAIGNTDMSQAAITLTLQQAMLEASQLAFSRIS 512
26991069  434 TDSAISNLASARDRIDITRGSIGARGNSLDIQAQENESLGLANQSTQSAIGDTDMASATIQLTLQQAMLEASQLAFARIS 513
148546714 434 LDSAIGNIASATNQVSSSISSIGGRGQAIDVQVETNEALSGENAKTQSSIRESDPAEVMIRLQMQSNMLQASLQAYAKIA 513
170722884 436 LDSAIANIQSGQDALNTAVTDIGARGKALEIQQNTNESLSIANSTTQSSIRDSDPATVLVRLTQQQTLLQASQAAFARVS 515
146281778 439 IALALTNLDKGIAAVDATRSSIGARLNTIDILTTENESLSITNASTQSSIRDTDMAEATAKLLLQQTMLEAAQLAFVRIS 518
71733470  443 LGSALGNIASSIDQASTARSAGGARQLAATAQGTTNDLLKGNNTVEQGTYVNADIVEATTRLTLQKTMLDASQQVFVQLS 522
66046699  443 LNTALGNMSSAIEQASTARSSGGARQLAATAQGTTNDLLKDNNTVEQGTYVNADIVEATTRLTLQKTMLDASQQVFTMLS 522
28869149  443 LGSALGNISSSIDQASTARSAGGARQLAATAQGTTNELLKGNNTVEQGTYVNADIVEATTRLTLQKTMLDASQQVFVQLS 522
104782835 435 LDSAIGNVASATNQVASSISSIGGRGQALDIQAETNEALSTENTKTQSSIREVDPATVMLRLQMQTNMLQASMQSFAKIS 514
146307862 554 GLNLFNQL 561
77457734  516 QLGLFNKI 523
229591864 533 QLSLFNKM 540
70729011  515 QLGLFNKV 522
167034936 513 QLSLFNKL 520
26991069  514 QLSLFDKI 521
148546714 514 GLSLVNYI 521
170722884 516 QLSLFNAI 523
146281778 519 QLTLFNQL 526
71733470  523 KLNLFSQL 530
66046699  523 KLNLFSQL 530
28869149  523 KLNLFSQL 530
104782835 515 GLSLVNYI 522
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap