Conserved Protein Domain Family
flgJ

?
PRK12713: flgJ 
flagellar rod assembly protein/muramidase FlgJ; Provisional
Statistics
?
PSSM-Id: 139173
View PSSM: PRK12713
Aligned: 4 rows
Threshold Bit Score: 615.216
Threshold Setting Gi: 187478190
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
33592484    1 MSFVSYTSRPGVQESVFDLGRLADLKRDAVKAPDGQRQQTEVARQFEALFLQMMLKRMREATPKEGLFDSQQTEMLQGMA 80 
33601546    1 MSFVSYTPRPGVQESVFDLGRLADLKRDAVKAPDGQRQQTEVARQFEALFLQMMLKRMREATPKEGLFDSQQTEMLQGMA 80 
33596144    1 MSFVSYTPRPGVQESVFDLGRLADLKRDAVKAPDGQRQQTEVARQFEALFLQMMLKRMREATPKEGLFDSQQTEMLQGMA 80 
187478190   1 MALTSNLAGAQPQDSVFDLGRLGNLKRGVGQNPADAAQQKEVAQQFEALFLQMMLKRMREATPKDGLFDSQQTEMLQSMS 80 
33592484   81 DEQLALQLASPDIGLAQALLGQMQQGQPPVPAAAAAGGDAAAARALAGTAAPAPLVRDLRGNYVQPDPAPRREVNALLDV 160
33601546   81 DEQLALQLASPGIGLAQALLGQMQQGQPPVPAAAAAGGDAAAARALAGTAAPAPLVRDLRGNYVQPDPAPRREVNALLDV 160
33596144   81 DEQLALQLASPGIGLAQALLGQMQQGQPPVPAAAAAGGDAAAARALAGTAAPAPLVRDLRGNYVQPDPAPRREVNALLDV 160
187478190  81 DEQMALQLAKPGVGLADALLKQMQQQNP----TPAQAGDEATANAVAGK--PPRLMRDQYGRYVQQ---PEGGVAALLNV 151
33592484  161 LRSNRARDRAMAAAEGAPSHVVDFVSRMSRAANVAAQQSGVPARLILGQAALESGWGRRELRHEDGSTSYNLFGIKAGAS 240
33601546  161 LRSNRARDRAMAAAEGAPSHVVDFVSRMSRAANVAAQQSGVPARLILGQAALESGWGRRELRHEDGSTSYNLFGIKAGAS 240
33596144  161 LRSNRARDRAMAAAEGAPSHVVDFVSRMSRAANVAAQQSGVPARLILGQAALESGWGRRELRHEDGSTSYNLFGIKAGAS 240
187478190 152 LRNNRPVDRAFAAAEGAPDHVVDFVSRMSRAANAAAAESGVPARLILGQAALESGWGKREIRQPDGSTSYNLFGIKAGAG 231
33592484  241 WKGKVVNVMTTEYVDGVAQKLVQSFRAYSSYEESFSDYARLIGNSPRYEaAVTQAGNEIEAARRIQEAGYATDPRYAEKL 320
33601546  241 WKGKVVNVMTTEYVDGVAQKLVQPFRAYSSYEESFSDYARLIGNSPRYE-AVTQAGNEIEAARRIQEAGYATDPRYAEKL 319
33596144  241 WKGKVVNVMTTEYVDGVAQKLVQPFRAYSSYEESFSDYARLIGNSPRYE-AVTQAGNEIEAARRIQEAGYATDPRYAEKL 319
187478190 232 WKGRVVHVLTTEYVDGVPQKVSQPFRAYNSYEESFADYARLVGGSARYE-TVAQASNETEAAHRIQRSGYATDPRYAEKL 310
33592484  321 ISIMGQLRTSVARADFSGGL 340
33601546  320 ISIMGQLRTSVARADFSGGL 339
33596144  320 ISIMGQLRTSVARADFSGGL 339
187478190 311 IKIMSQLRASVAQADFSGSP 330
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap