Conserved Protein Domain Family
flgJ

?
PRK12712: flgJ 
flagellar rod assembly protein/muramidase FlgJ; Provisional
Statistics
?
PSSM-Id: 139172
View PSSM: PRK12712
Aligned: 4 rows
Threshold Bit Score: 607.773
Threshold Setting Gi: 73539455
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
188592122   6 NGGALPAAGADLTQRFALDTQGFEALKHSARGGADANTLHAVAKQFEAVFTQMVLKSMRDATPQDGLFDNEQSKLYLSMM 85 
116694224   1 MNTARPPQAAELTQRFALDTQGFEALKHSARGGADANTLQAVARQFEAVFTQMVLKSMRDATPQDGLFDNEQSKLYMSMM 80 
94312674    1 MTGATLSGQSDISQRFALDTQGFEALKNQARAGNNSGSLQAAARQFEAVFTNMVLKSMRDATPSDGLFDNEQTKLYMSMM 80 
73539455    1 -MDSALSAQADVSQRFALDTQGFEALKQSARSGADTGTLRAAAKQFEAVFTQMVLKSMRDATPQDGVFDSEQGKLYMSML 79 
188592122  86 DQQLAQQMSSRGIGLADVMVRQLARATGTAMPSGM---NALTPAEAGNAADAEMARLLDSRGAGAMSADAAeqaDLPAIG 162
116694224  81 DQQLAQQMSSRGIGLADVMVRQLARATGTPMPAGM---SAMSPAESGKAADAEMARLLDSRGAGAIPADAGeqaDLPAIG 157
94312674   81 DQQLSQQLSTRGIGLADVMIRQLARATGQQLPPNM---ATAGGVTAASIQDAQMAGLLDGRGATDADGPAL------PVG 151
73539455   80 DQQLAQQMSSRGIGLAEVMVRQLARATGAQVPPGMisaNAAPGATGTAAADAEMARLLDGRGAGAATAQDG---DAPAIG 156
188592122 163 TIVAGQQWNPTAGLRQYQPQSYA--DRGQGEDRLGRLPDDAPAHVSAFVARMAGPAEAASRASGVPARLIVGQAALESGW 240
116694224 158 TIVPGQNWNPTAGLRQYQPQWYA--DRGQGEDRLGRLPDDAPSHVSAFVARMAGPAEAAARASGVPARLIVGQAALESGW 235
94312674  152 TTLPGPAWNPTAGVRQYQNQADW---QGNGQAQLGQLPNDTPEHISSFVNRMAGPAMVASRASGVPAKLIVGQAALESGW 228
73539455  157 TVVPGASWNPTAGLRQYREQDYAwqGQGQGGSNLGPLPDDAPAHVSAFVSRMSAPAEAASRVSGVPARLIVGQAALESGW 236
188592122 241 GQREITHADGSTTFNVFGIKAGPSWKGRVAEITTTEYIDGQPQKVRAKFRAYGSYDEACADYARLLTSNPRYAGVVSAAN 320
116694224 236 GQREITHADGSTTFNVFGIKAGASWKGRVAEITTTEYVDGQPQKVRAKFRAYGSYDEACADYARLLTNNPRYAGVVSAAS 315
94312674  229 GRREILNSDGSTSFNVFGIKAGANWKGPTTEVLTTEYVDGQPQKVRARFRAYGSYEEACNDYARLLTSNPRYAGVVAANS 308
73539455  237 GRREITHPDGSTTFNVFGIKAGANWKGRVAEVTTTEYVDGQPQKVRARFRAYGSYDEACADYARLLTTNPRYAAVVSAGS 316
188592122 321 AEDAAHGLQRAGYATDPSYGHKLVKIMKKVAA 352
116694224 316 AEEAAHGLQRAGYATDPAYGHKLVKIMKKVAA 347
94312674  309 ADEAAHGLQRAGYATDPAYGEKLVRIMKKVST 340
73539455  317 ADEAAHGLQRAGYATDPAYGQKLVQIMKKVSA 348
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap