Conserved Protein Domain Family
flgJ

?
PRK12708: flgJ 
peptidoglycan hydrolase; Reviewed
Statistics
?
PSSM-Id: 139168
View PSSM: PRK12708
Aligned: 20 rows
Threshold Bit Score: 124.566
Threshold Setting Gi: 153948142
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
120597310   1 MKVENPNGYLSKLNADELIKANGEQGALKMVSQQFEAQFLQTVLKQMRSATDAMADEDNPLTAKsNNGLYQDLHDAELAN 80 
146294545   1 MKVENPNGYLSKLNADELIKANSEQGALKMVSQQFEAQFLQTVLKQMRSATDAMADEDNPLTTKsNNGLYQDLHDAELAN 80 
126176151   1 MKVENTGGYLNKLNADDLIKANGEQGALKLVSQQFEAQFLQTVLKQMRSATDAMADEDNPLTTKsNNGIYQDLHDAELAS 80 
157959897   1 MKLDNNHSYLNQLNAGDLIKANGEHGALKLVSQQFEAQFLQTVLKQMRSASDVMADEDSPLSSQ-NDGMYRDWHDAELAG 79 
91794990    1 MKLENAGGYLAGLNASDLIKTNGEQGALRVVSQQFEAQFLQTVLKQMRSASDAMADEDSPFSSK-NDGLYRDLHDAELAM 79 
167626160   1 MKLDNNHSYLNQLDAGELIKANGEQGALKLVSQQFEAQFLQTVLKQMRSASDVMADKDSPLSSQ-NDGMYRDWHDAELAG 79 
212637790   1 MKLDNNHSYLNQLNASELIQANGEHGALKLVSQQFEAQFLQTVLKQMRSASDVMADKDSPLSSQ-NNGMYRDWHDAELAG 79 
108809050   3 EAINKSSPVIPGSFVGDLQPQDLEQ-----AAVQFEAVFMRTLLQQMRKAAEVLAADDDPFNSK-QQRMMRDFYDDKLAS 76 
108810753   3 EAINKSSPVIPGSFVGDLQPQDLEQ-----AAVQFEAVFMRTLLQQMRKAAEVLAADDDPFNSK-QQRMMRDFYDDKLAS 76 
145597822   3 EAINKSSPVIPGSFVGDLQPQDLEQ-----AAVQFEAVFMRTLLQQMRKAAEVLAADDDPFNSK-QQRMMRDFYDDKLAS 76 
120597310  81 RLSQVNGMGLAEVMTKQLSRSFQSEKDPVAFDPQQM------TTTAMQPALIMRPIVKDFK 135
146294545  81 RLSQVNGMGLAEVMTKQLSRSFQSEKDPVAFDPQQM------TTTAMQPALIMRPIVKDFK 135
126176151  81 RLSQVNGMGLAEVMTKQLSRSFQSEKDPVAFDPQQM------TTTAMQPALIMRPVVKDFK 135
157959897  80 RLSQMQSTGLASVMTKQLSSALKSSPETVASNQHETvnvanpNTRAMQPALIVPFIAKPQD 140
91794990   80 QLSKLQTMGLSEVMTKQLSGALKSNHEVVALQIDKPhq--amTTTAMQPALIMPKLAKDTP 138
167626160  80 RLSQMQSTGLAEVMTKQLSAGLKSEPEMVASNKQVNss---pNTAAMQPALILPFITKPQT 137
212637790  80 RLSQMQSTGLASVMSKQLEGALKSQPEMVASNSHTTan---aNTTAMQPALIVPFIAKPQA 137
108809050  77 TLASQRSSGIANLLIQQLGSK---------------------------------------- 97 
108810753  77 TLASQRSSGIANLLIQQLGSK---------------------------------------- 97 
145597822  77 TLASQRSSGIANLLIQQLGSK---------------------------------------- 97 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap