Conserved Protein Domain Family
flgH

?
PRK12700: flgH 
flagellar basal body L-ring protein; Reviewed
Statistics
?
PSSM-Id: 139164
View PSSM: PRK12700
Aligned: 5 rows
Threshold Bit Score: 360.909
Threshold Setting Gi: 163856438
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
33601544    1 MMLKTVLRLPVCAALLALAAGCAMIPPEPVVTGPLTAPPPPPPQPSARPNGSIYQPSAYGNYPLFEDRRPRNVGDIVTIV 80 
33596142    1 MMLKTVLRLPVCAALLALAAGCAMIPPEPVVTGPLTAPPPPPPQPSARPNGSIYQPSAYGNYPLFEDRRPRNVGDIVTIV 80 
33592482    1 -MLKTVLRLPVCAALLALAAGCAMIPPEPVVICPLTAPPPSPPQPSARPNGSIYQPSAYGNYPLFEDRRPRNVGDIVTIV 79 
187478188   1 VMLKTVARL-MSGLLLILSAGCALIPPEPVVIGPTTAAPPMPAAPAGRPNGSIYQPTAYGNYPLFEDRRPRNVGDIVTVM 79 
163856438   1 ---MIVLRLLFAAVLALAAAGCAMIPPEPVVTGPVTAAPPPPPMPAAQPNGSIYQPRVYGNYPLFEDRRPRNVGDIVTIV 77 
33601544   81 LEEKTNAAKGVATNTSRDGSATLGVAAAPRFMDGIINDKLDTDISGGNTANGTGKSSANNTFTGTITTTVIGVLPNGNLQ 160
33596142   81 LEEKTNAAKGVATNTSRDGSATLGVAAAPRFMDGVINDKLDTDISGGNTANGTGKSSANNTFTGTITTTVIGVLPNGNLQ 160
33592482   80 LEEKTNAAKGVATNTSRDGSATLGVAAAPRFMDGIINDKLDTDISGGNTANGTGKSSANNTFTGTITTTVIGVLPNGNLQ 159
187478188  80 LEEKTNAAKGVATNTSRSGGAKLGVAAAPKFMDGVVNNKLDTDITGDNTAKGTGNSSANNSFTGSITTTVVGVLPNGNLQ 159
163856438  78 LNERTNAAKNVATNTDRSGNVGLGIAATPGFMDSWANAKLNTDASGSNKASGKGDSSANNTFTGTITTTVIGVLPNGNLQ 157
33601544  161 IAGEKQIAINRGSEYVRFSGVVDPRSITGSNTVSSTRVADARIEYRSKGVMDEVQTMGWLQRFFLIASPF 230
33596142  161 IAGEKQIAINRGSEYVRFSGVVDPRSITGSNTVSSTRVADARIEYRSKGVMDEVQTMGWLQRFFLIASPF 230
33592482  160 IAGEKQIAINRGSEYVRFSGVVDPRSITGSNTVSSTRVADARIEYRSKGVMDEVQTMGWLQRFFLIASPF 229
187478188 160 IAGEKQIAINRGSEYVRLSGVVDPRSITGTNSVSSTRVADARIEYRSKGVMDEVQTMGWLQRFFLIASPF 229
163856438 158 VAGEKQIAINRGSEYVRFSGVVDPRSITGANSVSSTQVADARIEYRSKGVMDEVQTMGWLQRFFLIASPF 227
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap