Conserved Protein Domain Family
flgH

?
PRK12699: flgH 
flagellar basal body L-ring protein; Reviewed
Statistics
?
PSSM-Id: 105864
View PSSM: PRK12699
Aligned: 3 rows
Threshold Bit Score: 386.603
Threshold Setting Gi: 82702456
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
162219162   1 MKQSSCFDAINQRLLGTLISPVLIVMVSMVTGCSMiTPAPKVQQPMTIRPPEPLIIPVSQSNGGIYQAAFNYQGSGRYTP 80 
30248325   20 DGQCSGVMESFMRNRGHLVLPVLIVMICVVSGCAI-TPTPKVQQPMSVRPPDLPVIPPSQTSGGIYQAVFDYQGRGRYIP 98 
82702456    1 -----MVLSFSAKRRARVLGFMTGVPLALSGCVSLpPPAPIVHQPMSARAA---LPAPPPGNGAVYQDA------NQYHS 66 
162219162  81 LFEDRRARGIGDTIIVMLNEKTNASKKSGSNAQRDGGIDLSVPSF-LGLPFKSIFQDLDLEAKSSNKFDGKGESSSNNNF 159
30248325   99 LFEDRRARSIGDTIIVALNEKTNASKKTGSNAQRAGEIGLSVPSF-LGLPFKSIFQDLDLEATSSNKFDGKGESSSNNNF 177
82702456   67 LFIDRRARQIGDTLVILLTERTNASKRSNSSANKNGDVSFGIPPIvFGVP---ITKKIDLGASSSNDFAGKGEAASANNF 143
162219162 160 TGTITVTVIDILPNGNLLVSGEKQIGINQGHEFIRLSGVINPINVMNNTVSSVQVADARIEYRGTGYLDEAQTMGWLSRF 239
30248325  178 TGTIAVTVLDILPNGNLLVSGEKQIGINQGHEFIRLSGVINPINIINNTVSSIQVADARIEYRGNGYLDEVQTMGWLSRF 257
82702456  144 SGTITVTVVDVLPNSYLVVSGEKQLAMTQGSEYIRFSGVVRPETVISNTVSSIQVADARIEYKANGYIDEAQTMGWLSRF 223
162219162 240 FLSISPF 246
30248325  258 FLSISPF 264
82702456  224 FLTVAPF 230
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap