Conserved Protein Domain Family
flgG

?
PRK12692: flgG 
flagellar basal body rod protein FlgG; Reviewed
Statistics
?
PSSM-Id: 139158
View PSSM: PRK12692
Aligned: 11 rows
Threshold Bit Score: 489.358
Threshold Setting Gi: 188579867
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
158422258   1 MRALAIAATGMNAQQTNVEVIANNIANINTTGFKRARAEFSDLLYQSERTQGIPNRDGGQAIPEGAMLGLGVRTVGIRNL 80 
27381984    1 MKSLAIAATGMNAQQTNIEVIANNIANINSTSYKRARAEFTDLFYQMDRMQGVANVNGSSPIPEGANLGLGVKSAAIRKL 80 
170741836   1 MRALAIAATGMNAQQLNLEVIANNVANLNTTGFKGARAEFTDLLYQAERQQGVPNQTGQEAVPEGALLGLGVRAAAIRNL 80 
240137197   1 MRALAIAATGMSAQQLNLEVIANNIANLNTTGFKGARAEFTDLLYQAERQQGVPNQAGQEAVPEGAMLGLGVRAAAIRNL 80 
163850063   1 MRALAIAATGMSAQQLNLEVIANNIANLNTTGFKGARAEFTDLLYQAERQQGVPNQAGQEAVPEGAMLGLGVRAAAIRNL 80 
254559209   1 MRALAIAATGMSAQQLNLEVIANNIANLNTTGFKGARAEFTDLLYQAERQQGVPNQAGQEAVPEGAMLGLGVRAAAIRNL 80 
170748107   1 MRALAIAATGMNAQQLNVEVIANNISNLNTTAFKAARAEFKDLIYQAERPAGVPIQAGESAIPEGAMLGLGVRNTAIRNL 80 
218528666   1 MRALAIAATGMSAQQLNLEVIANNIANLNTTGFKGARAEFTDLLYQAERQQGVPNQAGQEAVPEGAMLGLGVRAAAIRNL 80 
188579867   1 MRALAIAATGMSAQQLNLEVIANNIANLNTTGFKGARAEFTDLLYQAERQQGAPNQAGQEAVPEGAMLGLGVRAAAIRNL 80 
115523179   1 MRSLAIAATGMSAQQLNVEVIANNIANINTTSYKRSRAEFTDLFYQIDRMQGVPNRVGEGAVPEGAKLGLGVRSAAVRKL 80 
90422610    1 MRALAIAATGMSAQQLNVEVIANNIANINTTSYKRARAEFTDLFYQIDRMQGVPNRVGEGAVPEGAKLGLGVRSAAVRKL 80 
158422258  81 HTQGPLTQTGNTLDLAVNGRGMFEITTPDGQTVYTRAGSFNRSATGQLVTSDGYVINPAIQFPNNATEIQVNESGQVYAT 160
27381984   81 HIQGALTQTGNPYDLAINGRGWFQVLGPNNEVQYTRAGSFNTNANSQLVTTDGYLLDPAITIPQGTVEVTVNQTGQVFAK 160
170741836  81 HRQGPLAQTSNNLDLAINGRGYFQVTNPNGEVNYTRAGSFNKSSTGQLVTLEGYVVEPAILFPANTVDVVINQSGQVYAK 160
240137197  81 HRQGSLANTGNQLDLAVNGRGYFQITSPAGEIQYTRAGSFNKNNAGQLVTMEGYAVDPAILIPQNTTQVTINESGQVFAK 160
163850063  81 HRQGSLANTGNQLDLAVNGRGYFQITSPAGEIQYTRAGSFNKNNAGQLVTMEGYAVDPAILIPQNTTQVTINESGQVFAK 160
254559209  81 HRQGSLANTGNQLDLAVNGRGYFQITSPAGEIQYTRAGSFNKNNAGQLVTMEGYAVDPAILIPQNTTQVTINESGQVFAK 160
170748107  81 HRQGPLNNTTNPLDLAINGRGWFQVTMPNGEINYTRAGSFNKNADGRLVTAEGYSVDPAIIIPQNAIDVVINETGQVMVK 160
218528666  81 HRQGSLANTGNQLDLAVNGRGYFQITSPAGEIQYTRAGSFNKNNAGQLVTMEGYAVDPAILIPQNTTQVTINESGQVFAK 160
188579867  81 HRQGSLANTGNQLDLAVNGRGYFQITSPAGEINYTRAGSFNKNNAGQLVTMEGYAVDPAILIPANTTQVTINESGQVFAK 160
115523179  81 HLQGALAQTGNAYDLAVNGRGWFQVVGPNGDTLYTRAGAFNTNADAQLVTADGYKVDPTILIPEGTAQVTVNESGQVYAK 160
90422610   81 HLQGALTQTGNPYDLAVNGRGWFQVVGPNGETLYTRAGAFNTNADGQLVTADGYNVDPAILIPQGTVEVTVNESGQVFAK 160
158422258 161 IPNQTNPQLLGQLTLVNFANESGMEPLGNNLYRETLASGQPIVGVAGDVGFGKIQQGYLEASNVDPVKEITELIAAQRSY 240
27381984  161 LDTEVNPRQIGQLNLANFANEAGLEPLGSNLYRETTASGTPVVGLPGDAGYGKINQKYLEASNVDPVKEITELISAQRAY 240
170741836 161 VDGQATPQLLGQLSIANFANESGLEPLGNGLYRETAASGAPVTGVAGDTGFGKVQQGYLESSNVDPVKEITSLITAQRAF 240
240137197 161 IDGQVALQNVGQLTLANFANDSGLEPLGNGLYRETPASGAPVVGNPGDVSYGKLQQGYLEGSNVDPVKEITSLITAQRAF 240
163850063 161 IDGQVALQNVGQLTLANFANDSGLEPLGNGLYRETPASGAPVVGNPGDVSYGKLQQGYLEGSNVDPVKEITSLITAQRAF 240
254559209 161 IDGQVALQNVGQLTLANFANDSGLEPLGNGLYRETPASGAPVVGNPGDVSYGKLQQGYLEGSNVDPVKEITSLITAQRAF 240
170748107 161 VDGQQLPQTIGQLQLANFTNDAGLEPLGNGLYRETAASGLPVTGFAADPGFGKIQQGYLETSNVDPVREITNLISAQRAF 240
218528666 161 IDGQVALQNVGQLTLANFANDSGLEPLGNGLYRETPASGAPVVGNPGDVSYGKLQQGYLEGSNVDPVKEITSLITAQRAF 240
188579867 161 TDGQVALQNIGQLTLANFANESGLEPLGNGLYRETPASGAPVVGNPGDVSYGKLQQGYLEGSNVDPVKEITSLITAQRAF 240
115523179 161 LDTEVTPRLLGQLTLANFANEAGLDPLGSNLYKETIASGTPVVGFPGDIGFGKIHQHYLESSNVDPVKEITELISAQRSY 240
90422610  161 LDGEITPRELGRLTLANFANEAGLDPLGSNLYKETLSSGVPVVGVPGDPGFGKIYHHYLESSNVDPVKEITELISAQRSY 240
158422258 241 EMNSKVIQAADEMSKTVSTGIR 262
27381984  241 EMNAKVIQASDEMASTVSKGLR 262
170741836 241 EMNSKVIQAADEMAGTVSKGIR 262
240137197 241 EMNSKVIQAADEMAGTVSKGIR 262
163850063 241 EMNSKVIQAADEMAGTVSKGIR 262
254559209 241 EMNSKVIQAADEMAGTVSKGIR 262
170748107 241 EMNSKVIQAADEMAGTISKGIR 262
218528666 241 EMNSKVIQAADEMAGTVSKGIR 262
188579867 241 EMNSKVIQAADEMAGTVSKGIR 262
115523179 241 EMNSKVIQAADEMASTISKGLR 262
90422610  241 EMNSKVITAADEMAQTVSKGLR 262
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap