Conserved Protein Domain Family
PRK12688

?
PRK12688: PRK12688 
flagellin; Reviewed
Statistics
?
PSSM-Id: 171664
View PSSM: PRK12688
Aligned: 9 rows
Threshold Bit Score: 826.439
Threshold Setting Gi: 91976149
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
91976149   1 MSGIVLSNAVRQNLSSLQATADLLATTQSRLSSGKKVNSALDNPTNFFTASGLDARSSDINNLLDGIGNGVQILQAANTG 80 
27380954   1 MSNIVLSASVRQNLLSLQSTADLLATTQERLSTGKKVNTALDNPTNFFTAQGLDNRASDISNLLDGINNGVQVLQAANTG 80 
27380955   1 MSGIVLSASVRQNLLSLQSTADLLATTQNRLSTGKSVNSALDNPTNFFTAQSLDNRASDINNLLDSIANGVQVLQAANTG 80 
27380956   1 MSGIVLSSSVRQNLLSLQSTADLLATTQSRLSTGKSVNSALDNPTNFFTAQSLDNRASDINNLLDGIANGVQVLQAANTG 80 
27380957   1 MSGIVLSASVRQNLLSLQSTADLLATTQNRLSTGKSVNSALDNPTNFFTAQSLDNRASDINNLLDGIANGVQVLQAANTG 80 
91976844   1 MSGIVLSNAVRQNLSSLQATADLLATTQSRLSSGKKVNSALDNPTNFFTAASLDSRSSDINNLLDGIGNGIQIIQAANTG 80 
90422999   1 MSGITLSSSVRQNLLSLQSTAELLSSTQSRLSTGKKVNSALDNPTNFFTASGLDARASDINNLLDGIGNGVQILQAANTG 80 
90423000   1 -MSVILSSAVRQNLLSLQSTADLLATTQSRLSTGKKVNTALDNPTNFFTASSLDSRASDINNLLDGIGNGVQILQAANTG 79 
90423001   1 MSNVVLSASVRQNLLSLQSTADLLSTTQNRLSSGKKVNSALDNPTNFFTAAGLDSRASDINNLLDGIGNGVQILQAASTG 80 
91976149  81 ITSLTKLVDSAKSIANQALQTVSGYSTKSNVSTTITGATANDLRGTTSYSSTSAAGNVLYSGAAGGATAATSAATLGGTA 160
27380954  81 ITSLQKLIDSAKSIANQALQTTVGYSTKSNVSTTIPGATPADLRGTTSYASATANSNVLYTGAAGGVTPVTGTAALGASL 160
27380955  81 LTSLQKLIDSAKSIANQALQTTVGYSTKSNVSTTISGATAADLRGTTSFASATASSNVLYNGTAGGTTAASGTTTLGASI 160
27380956  81 ITSLQKLIDSAKSIANQALQTTVGYSTKSNVSTTISGATAADLRGTTSFASATASSNVVYSGAAGGTTAASGTTTLGASI 160
27380957  81 ITSLQKLIDSAKSIANQALQTTVGYSTKSNVSATISGATAADLRGTTSFASATASSNVVFSGAAGGTTAASGTTTLGATI 160
91976844  81 ISSLTKLVDSAKSIANQALQSVAGYSSKSSVTTTIAGATADDLRGTSTYSNGLAQSIGLQDGQ-GTPGVVDGDTLLGGVA 159
90422999  81 ITSLQKLVDSAKSIANQALQTVAGYTSKSSVSTTIGGATADDLRGTATYSNGSAQSLALQDGQA-AAGVISGATLLGGTA 159
90423000  80 ITSLNKLVDSAKSIANQALQTVSGYTTKSNVSTTIAGATADDIRGTTTYANAFAVSGVVTDGTSGGASPITTATTLGGVA 159
90423001  81 ITSLNKLIDTAKSIANQALQTPVGYAPKSNVSTSISGATADDLRGTTSFVNTVASSNVLYTGTAGGATAVTAATKLGGTS 160
91976149 161 GSLVGSgvvnNNLTVPVAIDSTTRLFAAGGGGTAGLTtqanTTFTDGSKLSVNGKTITFSATAVPGASAVAAGSSLSStN 240
27380954 161 GSNAGSavgfAATAADGTTVLSGTATLLGTTASTTFG----APPADGDTITVNGKTITFRTGIPPTTQPTGWGLDASG-H 235
27380955 161 GSFAST----GATAGDGTTALTGAITLIATNGTTATGlagnAQPADGDTLTVNGKTITFRSGAAPASTAVPSGSGVSG-N 235
27380956 161 GSFAST----GATAGDGTTALTGAITLIATNGTTATGlagnAQPADGDTLTVNGKTITFRSGAAPASTAVPSGSGVSG-N 235
27380957 161 GSFAST----GATAGDGTTALTGAITLIATNGTTATGlagnAQPADGDTLTVNGKTITFRSGAAPASTAVPSGSGVSG-N 235
91976844 160 ATKTG-----GTVGGSGITA------------GTALSalgaNKPVAGDTMTVNGRTITFASGGAPDKATLPTGSGVEG-Q 221
90422999 160 ATKTGA-------------------TVTGLATTTLLSalgtNKPVAGNSLTVNGHTVTFANGDAPASTTLPAGSGVNN-Q 219
90423000 160 GALVGV----AATAGDGSTALSGTVTLAA--GATATTllaaAAPKDGDVLVVNGKSITFKGGAAPAAAGVATGSGVSG-N 232
90423001 161 AALVGA----VSTTGSGA-ALAGTTKLIDTSPTAATAligsAQPADGDTLIVNGKTITFRAGSAPGPSGVTVGSGVAG-N 234
91976149 241 VVTDSGGNSTVYLGTaadsaATVGDLMAAIDVASGAQSITAINATTKIATLTG-------GAGASSITGGTVTLKSSTGA 313
27380954 236 IATDGNGNSIVYEGTavaprATVNDVLSAIDLASGVKTATISAGAAAIAVSGStgpigtlQVASSISGGGQVTLKSSTGA 315
27380955 236 LVTDGNGNTTVYLAS-----ATVNDLLSAIDLASGVKTVSISSGAATIAVSASq-----pGAAVSTAAAGAVTLKSSTGA 305
27380956 236 LVTDGNGNTTVYLAS-----ATVNDLLSAIDLASGVKTVSISSGAATIAVSASq-----pGAAVSTAAAGAVTLKSSTGA 305
27380957 236 LVTDGNGNTTVYLAS-----ATVNDLLSAIDLASGVKTVSISSGAATIAVSASq-----pGAAVSTAAAGAVTLKSSTGA 305
91976844 222 LVTDGKGNSTVFLDS-----GTVQDVMNAIDLASGVQKVTITGGDATLAPS---------SGTAAAVTSNALVLSTSTGS 287
90422999 220 LVTDGKGNSTVYLNS-----GTVQDVMNAIDLASGVQNATITGGAATVANS---------SGANASIAANALVFSTSTGS 285
90423000 233 IVTDGSGNSQIYLTG-----GTVADVLKAVDLASGVAKTVNSAGAATI------------TGSTAAFAAGVLTVNSSTGA 295
90423001 235 LVTDGSGNTTVYLGTpaaplASVDDLSKAIDLASGVQQAVNANGTATITHS---------SGTDGATAGGILTLTTGTGA 305
91976149 314 DLSISGTADMLASLKLTA-SLGSSVTTVAAARATSSS---SLGSLIEDGSTLNVNGKTITFKNTLSTD---VNAIPTGfG 386
27380954 316 DLSVTGKADFLNKLGLTT-ATGAGNANVTANRSTTAG---SLGTLVQDGSTLNIDGHTITFKNAQTPQs--AASVTSG-G 388
27380955 306 DLSVTGKADLLKALGLTT-STGAGNATVNVNRTTSAA---SLGATIADGSTLNVDGHVITFKNAPIPGstgAPSVPSGyG 381
27380956 306 DLSVTGKADLLKALGLTT-AVGGGNATVNVNRTTSAA---SLGATIADGSTLNVDGHVITFKNAPIPGstgAPSVPTGyG 381
27380957 306 DLSVTGKADLLKALGLTT-AVGGGNATVNVNRTTSAA---SLGATIADGSTLNVDGHVITFKNAPIPGstgAPSVPTGyG 381
91976844 288 DLSISGNNTLLSAFGLNSgATGAGTFKAERTASPAAGdgvSRANMIQADSTLSINGKTITFKDAAIPA-----NADYGfG 362
90422999 286 DLSISGNNTLLSAFGLNSgATGVGSFTADRTATAAAGvgvSRAGMVQAGSTLTVNGKTITFQDAAIPA---AADYGSGkV 362
90423000 296 DLSVTGKADLLNALGLTT-SIGSGNVSVGAARTTAAT---TTSNLIQDGSTLNVNGKTITFSNAYQPL---PANVPSGsG 368
90423001 306 DLSITGKADLLKAIGLST-STGPGTTTVTQQRTTDTS---TVGSLIQDGSTLYVDGKTITFKNASVPI---AANVPTGsG 378
91976149 387 kpSGAHYATDGNGNSTVFLQDATAADMLSAIDLATGTKSATI-ATSVATVTTPAGNVASTV-LSGALKLSTGTAADLSIT 464
27380954 389 --VNGNIVTDGNGNSTVYIQSATLTDLLNSIDLATGVKTASI-FNGAASLTTTAGQIPSSVnSSGQLALSTGINADLSIT 465
27380955 382 --ASGNILTDGNGNSTVYLQAGTVNDVLKAIDLATGVQTATInANGTATLATATGQSNSSInTSGQLKLSTGVNADLSIT 459
27380956 382 --ASGNVLTDGNGNSTVYLQAGTVNDVLKAIDLATGVQTATInANGTATLATATGQTNSSInASGQLKLSTGVNADLSVT 459
27380957 382 --ASGNVLTDGNGNSTVYLQAGTVNDVLKAIDLATGVQTATInANGTATLATATGQTNSSInASGQLKLSTGVNADLSVT 459
91976844 363 kvGSQNVITDGNGNSTVYLQGGTIKDVLTAVDIASGAQTAPV-SNGAASLAVTAGSEASKVlSGGQLQISSGLAGDLKIS 441
90422999 363 --TGKNVITDGSGNSTVYLQGGTMNDVLTAIDIASGAQVAPV-SNGAATLAVAAGSEASKVlSGGQLQISSGLAGDLKLS 439
90423000 369 ieAGSHLQTDGKGNSIVYLQGATIADTLKAIDIATGVQTATn-AAGISTLATASGASASTVaANGTLKLSTGTLSDLSIA 447
90423001 379 --TTGNLVTDGVGNSTVYLQGGTIADVLKAIDLATGVETAVn-TSGTAVVTSSAGATASSVaASGALKLSTGLVSDLTIA 455
91976149 465 -GTGNALAALGLNGPTGTDTSFNASRTASAGNVSGKSLTFTSFKDGAAVNVTFGDGTNGTVKSLAQLNTALAANNMVAVV 543
27380954 466 -GTGNALHAFGLSGNTGTATAFTAARTSGVGGVSGKTLTFTSFNGGTPVNVTFGDGTNGTVKTLDQLNAQLQANHLTATI 544
27380955 460 -GTGNALNVFGLAGNTGSATAFTAARTSGIGGIAGKTLTFTSFNGGTAVNVTFGDGTNGTVKTLDQLNTKLQANNLSATI 538
27380956 460 -GTGNALNVLGLAGNTGTSTAFTAARTSGVGGITGKTLTFASFNGGTAVNVTFGDGTNGTVKTLDQLNTKLQANNLTATI 538
27380957 460 -GTGNALNVLGLAGNTGTSTAFTAARTSGVGGITGKTLTFASFNGGTAVNVTFGDGTNGTVKTLDQLNTKLQANNLTATI 538
91976844 442 -GTGNALSALGLAGNQGTATSFSVARTATAGGITGKTLSFEAFNGGTAVNVTIGDGTNGTVKSLADLNSALSVNNLAASI 520
90422999 440 -GTGNALSALGLAGAQGTGTSFNVARTASAGGISGKTLSFESFNGGTAVNITIGDGTNGTVKSLTDLNTALKANNMQASI 518
90423000 448 gGVGNALSALGLDGPTHTSSTFTATRAAGAGGIDGKTLTFSSFNGGSAVNVTLGDGTNGTVKTLAQLKTALQANNLDATV 527
90423001 456 -GSGNALAALGLAGNTGTATVFSAARNAGIGGISGKTLTFTSFKGGTPVNVTFGNGTNGTVKSLAQLNAALFANNMSATV 534
91976149 544 DnATGKLTISASNDFASHTLGSS-DGGAIGGTLSSTLTFSSASAPVADTNAQNTRAGLVKQYNDIMDQIKTTAQDASFNG 622
27380954 545 D-ANGLLTVTTVNEYASSTLGSTtAGGTVGGTITGILAFTTAQPPVQDPVAQTARSNLVNQFNNILAQIDTTSQDSSFNG 623
27380955 539 D-ANGLLTITASNDYASSTLGSTsAGGAIGGTLTSALTFSTASNPVQDGVAQTARANLVSQYNNILNQIDTTSQDSSFNG 617
27380956 539 D-ANGLLTVSTTNDYASSTIGSSaAGGAIGGTLTTALTFSTASSPVQDSVAQTSRASLVNQYNNILNQIDSTSQDSSFNG 617
27380957 539 D-ANGLLTVSTTNDYASSTIGSSaAGGAIGGTLTTSLTFSTASSPVQDTVAQTSRANLVSQYNNILNQIDTTSQDSSFNG 617
91976844 521 D-TTGKLTISASNDYASSTIGSTeSGGKIGGTAASL--FSTASAPVADVNAQNTRANLVTQYNNIIQQIKTTAQDASFNG 597
90422999 519 D-TTGKLTISAANDYASSTLGSTlSGGKISGTAASL--FSTPTDPVADLVAQTTRGNLVKQYNDVMDQIKTTAQDASFNG 595
90423000 528 D-ASGKLTISAGNDYASSTLGSTlSGGSIGGTLTTSTTFTIAAAPVADTVAQTTRANLVTQYNNILNQINTTAQDASFNG 606
90423001 535 D-ATGKLVITAGNDYASSTLGSAlDGGTLGGTVTTTLSFTNPAPPSADLNSQATRANLVRQYNDIIAQITTTSQDASFNG 613
91976149 623 VNLLDGDTLKLVFNETGKSTISIQGVSYNPTGLGLSTLTSGTDFIDNDATNSVLAKLSTASTTLRSQASAFGSNLSIVQA 702
27380954 624 VNLLNGDTLKLVFNETGSSTLGINGVVFNAAGLGLSNLVNGVDFIDNGATNKVLTSLNAASSTLRSEGSALGSNLSIVQV 703
27380955 618 VNLLNGDQLKLVFDETGKSSLNITGVTYNSKGLGLAALTVGVDFIDNAAANRVLTNLNAASSTLRSEASSLGSNLSVVQI 697
27380956 618 VNLLNGDQLKLVFDETGKSNLSITGVTYNSKGLGLAALTGGVDFIDNAATNKVLTNLNSASSTLRSEASSLGSNLTIVQV 697
27380957 618 VNLLNGDQLKLVFDETGKSNLSITGVTYNSKGLGLAALTSGVDFIDNAATNKVLSNLNAASSTLRSEASSLGSNLSVVQV 697
91976844 598 VNLLGGDTLKLVFNETGKSTLSIQGVTFDPAGLGLSSLKSGKDFIDNANTNKVLSSLNTASSTLRSQASALGSNLSIVQT 677
90422999 596 VNLLGGDTLKLVFNETGKSTLSIQGVTFDPTGLGLSKLTSGTDFIDNAATNKTLATLTTAATTLRSQASALGSNLSIVQT 675
90423000 607 VNLLNGDNLKLTFNETGKSTLNVQGVTFNAAGLGLSNLTGGTDFIDNSNTNKTLATLTTASTALRSQASALGSNLSIVQL 686
90423001 614 VNLLAGDTLKLVFNETGKSTLNITGAALTPAGLGLPTLIAGTDLVDNNSANKTLAALNVASTALRSQASSLGSNLSIVQI 693
91976149 703 RQDFSKNLINVLQTGSSNLTLADTNEEAANSQALSTRQSIAVSALSLANQSQQGVLQLLR 762
27380954 704 RQDFSKNLINVLQTGSSNLTLADTNEEAANSQALSTRQSIAVSALSLANQSQQSVLQLLR 763
27380955 698 RQDFNKNLINVLQTGSSNLTLADTNVEAANSQALSTRQSIAVSALSLANQSQQSVLQLLR 757
27380956 698 RQDFNKNLINVLQTGSSNLTLADTNVEAANSQALSTRQSIAVSALSLANQSQQSVLQLLR 757
27380957 698 RQDFNKSLINVLQTGSSNLTLADTNTEAANSQALSTRQSIAVSALSLANQSQQSVLQLLR 757
91976844 678 RQDFSKNLINVLQTGSSNLTLADTNEEAANSQALSTRQSIAVSALSLANSSQQSVLQLLR 737
90422999 676 RQDFSKSLINVLQTGSSNLTLADTNEEAANSQALSTRQSIAVSALSLANSSQQGVLQLLR 735
90423000 687 RQDFSKSLINVLQTGASNLTLADTNEEAANSQALSTRQSIAVSALSLANTSQQSVLQLLR 746
90423001 694 RQDFAKNLINVLQTGSSNLTLADTNEEAANSQALSTRQSIAVSALALANQSQQSVLKLLQ 753
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap