Conserved Protein Domain Family
PRK12687

?
PRK12687: PRK12687 
flagellin; Reviewed
Statistics
?
PSSM-Id: 105853
View PSSM: PRK12687
Aligned: 4 rows
Threshold Bit Score: 384.402
Threshold Setting Gi: 27381977
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
27381976    2 GSSLLTNSSAMTALQTLRNVSTQLATTQNRISTGQRVSTASDNSAYWSIATSMRSDNAALSAVSDSLGLSAAMVDTEYTA 81 
27381977    1 MSSLLTNSTAMTALQTLRSVSSQLSTTQTRISTGQRVSTASDNAAYWSIATSMRSDNAALSAVSDSLGLSAATVDTEYTA 80 
115523186   1 MSSLMTNTSAMTALQTLRNVNSSLATTQNRISTGYRVATASDNSAYWSIATTMRSDNEALSAVSDALGLGAATVDTMYTA 80 
90422617    1 MSSLLTNTSAMTALQTLRNVSSSLATTQNRISTGYRVATASDNSAYWSIATTMRSDNEALSAVSDALGLGAATVDTMYTA 80 
27381976   82 LNTVIGDKNSGLTKLQALLVEAKTAGIDRTKIQAEVTQIQQDMKLKSDSATINGINWLSIDITPSSSTATPTtfnLVSSY 161
27381977   81 LNTVIGDKDSGLTKLQALLVEAKTAGIDRSKIQADVTQIQNQLKSTADSATINGINWLSIDTTPSSSTATPTsfnLVSSY 160
115523186  81 LTSVVGDSKGGLTALKAKLVAAREPGIDRTKIQSEITAIQADLKNTAGLAVFNGENWLAVDSSAASYNATKS---VVSSF 157
90422617   81 LTSVVGDSKSGLTALKAKLVAAREPGVDRVKVQSEITAIQDDLKNTAGLAVFNGENWLSVDSSVTGYNATKS---VVSSF 157
27381976  162 SRVGGTPTIGSITVTTATYALYTTGGSSTTGILD-TVVGGSTGASVASINIGALTDSATDQTKLDGYINQVTAAINSVAS 240
27381977  161 SRVGNTPTIGSITVTTATYALYTTGGSSTTGILD-AVVGGSTGASVSSINIGALTDSATDQTKLDGYIAQVTAAIGSVAS 239
115523186 158 TRVGGAVAVKTIDINISKLSLYDSNGA--IGILDkSVTVGTATASVSSIDIHLLTDNATDLAILDGMIGIVDQALGSVTQ 235
90422617  158 TRVGGTVAIKTIDVNIDKLKLYDPNGGTPAGIMDkTVTVGTATDAVSTIDIHLLTDSAADLTKLDGLIGIVDQALGSVTQ 237
27381976  241 AAANLGAVKNRIATNTEFVKNLMDSVDRGIGQLVDADMNAESTRLQALQTQQQLGVQALSIANQNSQSILSLFR 314
27381977  240 AAANLGAVKNRISTNTEFVKNLMDSVDRGVGQLVDADMNQESTRLAALQVQQQLGVQALSIANNSSQSILSLFR 313
115523186 236 ASADLGATKTRIDSNSNFVKSLRDAIDRGIGQLVDADMNAESTRLQALQTQQQLGIQALSIANQGSQSILSLFK 309
90422617  238 ASADLGATKTRIDSNSNFIKSLRDAIDRGVGQLVDADMNAESTRLQALQTQQQLGIQALSIANSGSQSILSLFK 311
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap