Conserved Protein Domain Family
PRK12675

?
PRK12675: PRK12675 
putative monovalent cation/H+ antiporter subunit G; Reviewed
Statistics
?
PSSM-Id: 171652
View PSSM: PRK12675
Aligned: 6 rows
Threshold Bit Score: 162.263
Threshold Setting Gi: 57640555
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
161484710   1 MIYLLFLVFGYSIMVFGALGLVRFPDLYTRLHAATKCDTGGMIGIILGLVFLTDaSLFIKAKMFLLLFLIAMINPMVSHA 80 
14521409    1 MIELIPLLFGYSIMFFGALGVVRFPDVYTRLHAATKCDTGGIMGIVLGLSLIVN-SWSVRVKLIFLLVLIAMINPMISHA 79 
14590796    1 MLELLPLLFGYLIMFFGALGVVRFPDVYTRLHAATKCDTGGIMGIILGLSMIVN-SWAIRTKLVILLIFIAMINPMISHA 79 
242398827   1 MIEYFLLLLGESIMIFGTLGILRFPDVYTRLHAATKCDTGGAMTILMALAIASEaSLLIKLKFLVLAFLIALINPMVSHA 80 
57640555    1 MIELLFLLFGLFIMFFGALGLLRFPDVYTRLHATAKCDTGGAINILLALALASDfPLTGKLKFLVIAFTIAMINPMVSHA 80 
212224482   1 MIETILLLFGGAVMLFGALGILRFPDVYTRLHAATKCDTGGAMSIILALVLMMDaPALVRLKFLVLAFLIAMINPMVSHA 80 
161484710  81 IARGAYKMGIKPQVKVDMYGWDNP 104
14521409   80 IARGAYKMGVKPVGKVDMYAWDNA 103
14590796   80 IARGAYKGGVKPKVKVDMYAWDNP 103
242398827  81 IARGAYKYGIKPEVVVDMYAWDNP 104
57640555   81 IARAAYKSGIKPKAVVDMYAWDNP 104
212224482  81 IARGAYKYGVKPKVVVDMYAWDNP 104
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap