Conserved Protein Domain Family
flgF

?
PRK12643: flgF 
flagellar basal body rod protein FlgF; Reviewed
Links
?
Statistics
?
PSSM-Id: 139117
View PSSM: PRK12643
Aligned: 12 rows
Threshold Bit Score: 375.722
Threshold Setting Gi: 22126389
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
51596012    1 MDHAIYTAMGAARQSLELQAVTANNLANASTPGFRAQLAAMRAVPIDGPSLATRTMVTTSTPGVDISQGTMNFSGRPLDV 80 
22126389    1 MDHAIYTAMGAARQSLELQAVTANNLANASTPGFRAQLAAMRAVPIDGPSLATRTMVTTSTPGVDISQGTMNFSGRPLDV 80 
218928923   1 MDHAIYTAMGAARQSLELQAVTANNLANASTPGFRAQLAAMRAVPIDGPSLATRTMVTTSTPGVDISQGTMNFSGRPLDV 80 
45441408    1 MDHAIYTAMGAARQSLELQAVTANNLANASTPGFRAQLAAMRAVPIDGPSLATRTMVTTSTPGVDISQGTMNFSGRPLDV 80 
162420290   1 MDHAIYTAMGAARQSLELQAVTANNLANASTPGFRAQLAAMRAVPIDGPSLATRTMVTTSTPGVDISQGTMNFSGRPLDV 80 
108807174   1 MDHAIYTAMGAARQSLELQAVTANNLANASTPGFRAQLAAMRAVPIDGPSLATRTMVTTSTPGVDISQGTMNFSGRPLDV 80 
108812482   1 MDHAIYTAMGAARQSLELQAVTANNLANASTPGFRAQLAAMRAVPIDGPSLATRTMVTTSTPGVDISQGTMNFSGRPLDV 80 
145598609   1 MDHAIYTAMGAARQSLELQAVTANNLANASTPGFRAQLAAMRAVPIDGPSLATRTMVTTSTPGVDISQGTMNFSGRPLDV 80 
294504029   1 MDHAIYTAMGAARQSLELQAVTANNLANASTPGFRAQLAAMRAVPIDGPSLATRTMVTTSTPGVDISQGTMNFSGRPLDV 80 
153947059   1 MDHAIYTAMGAARQSLELQAVTANNLANASTPGFRAQLAAMRAVPIDGPSLATRTMVTTSTPGVDISQGTMNFSGRPLDV 80 
170024646   1 MDHAIYTAMGAARQSLELQAVTANNLANASTPGFRAQLAAMRAVPIDGPSLATRTMVTTSTPGVDISQGTMNFSGRPLDV 80 
186895115   1 MDHAIYTAMGAARQSLELQAVTANNLANASTPGFRAQLAAMRAVPIDGPSLATRTMVTTSTPGVDISQGTMNFSGRPLDV 80 
51596012   81 ALQQDGYLAVQLPDGSEAYTRNGNIQISANGQMTVQGYPLMGDNGPIDVPPQAAVTIAADGTISALNAGDSPNTIAQLGQ 160
22126389   81 ALQQDGYLAVQLPDGSEAYTRNGNIQISANGQMTVQGYPLMGDNGPIDVPPQAAVTIAADGTISALNAGDSPNTIAQLGQ 160
218928923  81 ALQQDGYLAVQLPDGSEAYTRNGNIQISANGQMTVQGYPLMGDNGPIDVPPQAAVTIAADGTISALNAGDSPNTIAQLGQ 160
45441408   81 ALQQDGYLAVQLPDGSEAYTRNGNIQISANGQMTVQGYPLMGDNGPIDVPPQAAVTIAADGTISALNAGDSPNTIAQLGQ 160
162420290  81 ALQQDGYLAVQLPDGSEAYTRNGNIQISANGQMTVQGYPLMGDNGPIDVPPQAAVTIAADGTISALNAGDSPNTIAQLGQ 160
108807174  81 ALQQDGYLAVQLPDGSEAYTRNGNIQISANGQMTVQGYPLMGDNGPIDVPPQAAVTIAADGTISALNAGDSPNTIAQLGQ 160
108812482  81 ALQQDGYLAVQLPDGSEAYTRNGNIQISANGQMTVQGYPLMGDNGPIDVPPQAAVTIAADGTISALNAGDSPNTIAQLGQ 160
145598609  81 ALQQDGYLAVQLPDGSEAYTRNGNIQISANGQMTVQGYPLMGDNGPIDVPPQAAVTIAADGTISALNAGDSPNTIAQLGQ 160
294504029  81 ALQQDGYLAVQLPDGSEAYTRNGNIQISANGQMTVQGYPLMGDNGPIDVPPQAAVTIAADGTISALNAGDSPNTIAQLGQ 160
153947059  81 ALQQDGYLAVQLPDGSEAYTRNGNIQISANGQMTVQGYPLMGDNGPIDVPPQAAVTIAADGTISALNAGDSPNTIAQLGQ 160
170024646  81 ALQQDGYLAVQLPDGSEAYTRNGNIQISANGQMTVQGYPLMGDNGPIDVPPQAAVTIAADGTISALNAGDSPNTIAQLGQ 160
186895115  81 ALQQDGYLAVQLPDGSEAYTRNGNIQISANGQMTVQGYPLMGDNGPIDVPPQAAVTIAADGTISALNAGDSPNAIAQLGQ 160
51596012  161 IKRVQATAGEMMHGDDGLFHLTPETQQARGAQLPNDPLVKimPGVLEGSNV 211
22126389  161 IKRVQATAGEMMHGDDGLFHLTPETQQARGAQLPNDPLVK--PGEREHQWL 209
218928923 161 IKRVQATAGEMMHGDDGLFHLTPETQQARGAQLPNDPLVK--PGEREHQWL 209
45441408  161 IKRVQATAGEMMHGDDGLFHLTPETQQARGAQLPNDPLVK--PGEREHQWL 209
162420290 161 IKRVQATAGEMMHGDDGLFHLTPETQQARGAQLPNDPLVK--PGEREHQWL 209
108807174 161 IKRVQATAGEMMHGDDGLFHLTPETQQARGAQLPNDPLVK--PGEREHQWL 209
108812482 161 IKRVQATAGEMMHGDDGLFHLTPETQQARGAQLPNDPLVK--PGEREHQWL 209
145598609 161 IKRVQATAGEMMHGDDGLFHLTPETQQARGAQLPNDPLVK--PGEREHQWL 209
294504029 161 IKRVQATAGEMMHGDDGLFHLTPETQQARGAQLPNDPLVK--PGEREHQWL 209
153947059 161 IKRVQATAGEMMHGDDGLFHLTPETQQARGAQLPNDPLVKimPGVLEGSNV 211
170024646 161 IKRVQATAGEMMHGDDGLFHLTPETQQARGAQLPNDPLVKimPGVLEGSNV 211
186895115 161 IKRVQATAGEMMHGDDGLFHLTPETQQARGAQLPNDPLVKimPGVLEGSNV 211
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap