Conserved Protein Domain Family
flgB

?
PRK12624: flgB 
flagellar basal body rod protein FlgB; Provisional
Statistics
?
PSSM-Id: 139107
View PSSM: PRK12624
Aligned: 6 rows
Threshold Bit Score: 253.836
Threshold Setting Gi: 189910284
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
45656203    1 MFEKTHFMKTQDLLERGMNNSIFKRKVISDNIANADVPHFKRSEVIFESMIKRAIESEKIEAIKEVPTQISDERHIQFFK 80 
24213047    1 MFEKTHFMKTQDLLERGMNNSIFKRKVISDNIANADVPHFKRSEVIFESMIKRAIESEKIEAIKEVPTQISDERHIQFFK 80 
189910284   1 MFEATHFMKTQDLLERGLGAATQRRKVITDNIANADVPNFKRSEVVFESMLKRAIESEKIEKEKAVPTKISNDRHIEFFK 80 
183220164   1 MFEATHFMKTQDLLERGLGAATQRRKVITDNIANADVPNFKRSEVVFESMLKRAIESEKIEKEKAVPTKISNDRHIEFFK 80 
116327146   1 MFEKTHFMKTQDLLERGMNNSILKRKVISDNIANADVPHFKRSEVIFESMIKRAIESEKIETLKEVPTQISDERHIQFFK 80 
116332197   1 MFEKTHFMKTQDLLERGMNNSILKRKVISDNIANADVPHFKRSEVIFESMIKRAIESEKIETLKEVPTQISDERHIQFFK 80 
45656203   81 PLDYREVQPKANTDYLTTMRADGNNVDVEKEVVEASNSQMQYMMMAERINQNYRELKQVMRMA 143
24213047   81 PLDYREVQPKANTDYLTTMRADGNNVDVEKEVVEASNSQMQYMMMAERINQNYRELKQVMRMA 143
189910284  81 PLDYRDAKPKTNLDYLTTMRPDGNNVDIEKEVVEANQNQMSYSLMIDRLNQNNRLLNIVMRTN 143
183220164  81 PLDYRDAKPKTNLDYLTTMRPDGNNVDIEKEVVEANQNQMSYSLMIDRLNQNNRLLNIVMRTN 143
116327146  81 PLDYREVQPKTNIDYLTTMRADGNNVDVEKEVVEASNSQMQYMIMTERLNQNYRDLKQVMRMA 143
116332197  81 PLDYREVQPKTNIDYLTTMRADGNNVDVEKEVVEASNSQMQYMIMTERLNQNYRDLKQVMRMA 143
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap