Conserved Protein Domain Family
flgB

?
PRK12621: flgB 
flagellar basal body rod protein FlgB; Provisional
Statistics
?
PSSM-Id: 171613
View PSSM: PRK12621
Aligned: 9 rows
Threshold Bit Score: 233.105
Threshold Setting Gi: 239909137
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
242278629   1 MKGLFGSHIQLTGKVLDLRLQRQNLVSSNLANVNTPGYKEKRLEFEEDLQKAMNLDAKGKMTRTSKMHIPTAFDANKFEG 80 
46578732    1 MKNMYESHVNLVGKVMDMQLQRQNVVMSNIANVRTPGYKPRELEFEKELQSALGLDAKGRMTITEKQHLPAVFDPEGFGP 80 
218887373   1 MKSLYEPHVNLVGKVMDMQLQRQNVVMSNIANVRTPGYKPRELEFEKQLQSALGLDAKGRMTRTEQNHLPSEFSADGFNA 80 
120603704   1 MKSMYESHVNLVGKVMDMQLQRQNVVMSNIANVRTPGYKPRELEFEKELQSALGLDAKGRMTITEKQHLPAVFDPEGFGP 80 
78355403   20 MKTLFGQHMEVTAKVMDMQLKRQNVIMSNMANVRTPGYKARELDFEKDLQAALSLGTEGKIARTHEKHVPATFDPETFGP 99 
220904842   1 MKSLFSSQIGLVGTVMNMQLDRQNIIAGNLANIDTPNYKPRELSFEKELQTALGQDMEGQMSRTSAEHIPSTFDPSSFRP 80 
239909137   1 MKTIFSSNLGLLGKVMDLHQERQNVVMSNLANQDVPAFKARTLEFEQELQAALNIDGRGKMTRTQGGHMPTVFNAAGFEG 80 
256830789   1 MKSLFPDHIDLTAKVMDFQLQRQNIVSANLANINTPGYKARTLEFEKDLQAALGLSESGAVARTHPDHFPLAFAADQTEA 80 
94987302    1 MKSLYEPHVNLVAKVMDMQLQRQNVIMSNIANVNTPRYRPRTIEFEDQLQKALGLDMRGRMSRTEENHLPAVFNPEGFNA 80 
242278629  81 DTISKFEPRVIHGENRVDMDKEMVTMAKNTLYYNALSQVIGKNFQGMTKIIQEGAR 136
46578732   81 EWSKTFKPRVVHGEDRVNLDKEMTKMAKASLQYNALATVIKGNFEGIKTIIMEGQK 136
218887373  81 DWEKAAKPRVIHGEDRVNLDKEMAKMAKNSLHYSALTTVIRGNLEGVKNIIQEGQK 136
120603704  81 EWSKTFKPRVVHGEDRVNLDKEMTKMAKASLQYNALATVIKGNFEGIKTIIMEGQK 136
78355403  100 EWTKAFRPRVVHGEDQVDLDKEMAKMAKNTLQYNTLSTIIKGNFQGLKDVIMTGQK 155
220904842  81 EWSEAFKPRLIHGEDRVNLDKEMAKHSKNQLQFTALAQVLTKTFEGIHTVIQDGKQ 136
239909137  81 NIDMGWKPRVVQGLDSVDMDKEMAVMAKNTLMYNALTDITKKSFEGLQKVIMDGGK 136
256830789  81 SVTKSLTPRVVQGVDNVDLDKEMAAMAKNNLLYNTLATVMQKSFTGLKQTIADGGK 136
94987302   81 EWDKAIKPTVVHGEDRVNLDKEMANMAKNSLQYNALTQVIKGNLDGVKNIIMEGSK 136
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap