Conserved Protein Domain Family
PRK12615

?
PRK12615: PRK12615 
galactose-6-phosphate isomerase subunit LacB; Reviewed
Statistics
?
PSSM-Id: 171610
View PSSM: PRK12615
Aligned: 17 rows
Threshold Bit Score: 351.251
Threshold Setting Gi: 157149701
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15675560    1 MKIAIGCDHIVTNEKMAVSDFLKSKGYDVIDCGTYDHTRTHYPIFGKKVGEAVVNGQADLGVCICGTGVGINNAVNKVPG 80 
94994906    2 MKIAIGCDHIVTNEKMAVSDFLKSKGYDVIDCGTYDHTRTHYPIFGKKVGEAVVSGQADLGVCICGTGVGINNAVNKVPG 81 
19746612    1 MKIAIGCDHIVTNEKMAVSDFLKSKGYDVIDCGTYDHTRTHYPIFGKKVGEAVVNEQADLGVCICGTGVGINNAVNKVPG 80 
21911020    1 MKIAIGCDHIVTNEKMAVSDFLKSKGYDVIDYGTYDHTRTHYPIFGKKVGEAVVSGQADLGVCICGTGVGINNAVNKVPG 80 
139473268   1 MKIAIGCDHIVTNEKMAVSDFLKSKGYDVIDCGTYDHTRTHYPIFGKKVGEAVVNGQADLGVCICGTGVGINNAVNKVPG 80 
157149736   1 MKIAIGCDHIVTNEKMAVSDFLKSKGYEVLDFGTYDHTRTHYPIFGKKVGEAVVSGQADLGVCICGTGVGINNAVNKVPG 80 
195977595   1 MKIAIGCDHIVTNEKMAVSDFLKSKGYEVIDCGTYDHTRTHYPIFGKRVGEAVANGRADLGVCICGTGVGINNAVNKVSG 80 
209559827   1 MKIAIGCDHIVTNEKMAVSDFLKSKGYDVIDCGTYDHTRTHYPIFGKKVGEAVVCGQADLGVCICGTGVGINNAVNKVPG 80 
225869097   1 MKIAIGCDHIVTDEKMAVSDFLKSKGYEVIDCGTYDHTRTHYPIFGKRVGEAVANGLADLGVCICGTGVGITNAVNKVPG 80 
225869951   1 MKIAIGCDHIVTDEKMAVSDFLKSKGYEVIDCGTYDHTRTHYPIFGKRVGEAVANGLADLGVCICGTGVGITNAVNKVPG 80 
15675560   81 IRSALVRDMTTALYAKEELNANVIGFGGKITGELLMCDIIDAFIKAEYKETEENKKLIAKIAHLESHHANQEDPDFFTEF 160
94994906   82 IRSALVRDMTTALYAKEELNANVIGFGGKITGELLMCDIIDAFIKAEYKETEENKKLIAKIAHLETHHANQEDPDFFTEF 161
19746612   81 IRSALVRDMTTALYAKEELNANVIGFGGKITGELLMCDIIDAFIKAEYKETEENKKLIAKIAHLESHHASQEDPDFFTEF 160
21911020   81 IRSALVRDMTTALYAKEELNANVIGFGGKITGELLMCDIIDAFIKAEYKETEENKKLIAKIAHLESHHANQEDPDFFTEF 160
139473268  81 IRSALVRDMTTALYAKEELNANVIGFGGKITGELLMCDIIDAFIKAEYKETEENKKLIAKIAHLETHHANQEDPDFFTEF 160
157149736  81 VRSALVRDMTTALYAKEELNANVIGFGGKITGELLMCDIIEAFINAEYKPSEENKKLIAKIEHVETHNAHQADANFFTEF 160
195977595  81 IRSALVRDMTTALYAKEELNANVIGFGGKITGELLMCDIIDAFIKADYRETDDNKKLLAKIAHLETQHVNQEDPDFFNEF 160
209559827  81 IRSALVRDMTTALYAKEELNANVIGFGGKITGELLMCDIIDAFIKAEYKETEENKKLIAKIAHLETHHANQEDPDFFTEF 160
225869097  81 IRSALVRDMTTALYAKEELNANVIGFGGKITGELLMCDIIEAFIKAEYKETEENKKLIAKIAHLESHNANQEDPDFFTEF 160
225869951  81 IRSALVRDMTTALYAKEELNANVIGFGGKITGELLMCDIIEAFIKADYKETEENKKLIAKIAHLESHNANQEDPDFFTEF 160
15675560  161 LEKWDRGEYHD 171
94994906  162 LEKWDRGEYHD 172
19746612  161 LERWDRGEYHD 171
21911020  161 LEKWDRGEYHD 171
139473268 161 LEKWDRGEYHD 171
157149736 161 LEKWDRGEYHD 171
195977595 161 LDKWDRGDYQD 171
209559827 161 LEKWDRGEYHD 171
225869097 161 LEKWDRGEYHD 171
225869951 161 LDKWDRGDYHD 171
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap