Conserved Protein Domain Family
PRK12613

?
PRK12613: PRK12613 
galactose-6-phosphate isomerase subunit LacA; Provisional
Statistics
?
PSSM-Id: 171609
View PSSM: PRK12613
Aligned: 18 rows
Threshold Bit Score: 255.624
Threshold Setting Gi: 225869950
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
94994907    1 MAIILGADAHGNALKELIKSFLQEESYDIIDVTDINSDFIDNTLAVAKAVNEAEGRLGIMVDAYGAGPFMVATKLKGMVA 80 
94989030    1 MAIILGADAHGNALKELIKSFLQEESYDIIDVTDINSDFIDNTLAVAKAVNEAEGRLGIMVDAYGAGPFMVATKLKGMVA 80 
19746613    1 MAIILGADAHGNALKELIKSFLQEESYDIIDVTDINSDFIDNTLAVAKAVNEAEGRLGIMVDAYGAGPFMVATKLKGMVA 80 
94992920    1 MAIILGADAHGNALKELIKSFLQEESYDIIDVTDINSDFIDNTLAVAKAVNEAEGRLGIMVDAYGAGPFMVATKLKGMVA 80 
71911211    1 MAIILGADAHGNALKELIKSFLQEEGYDIIDVTDINSDFIDNTLAVAKAVNEAEGRLGIMVDAYGAGPFMVATKLKGMVA 80 
139473267   1 MAIILGADAHGNALKELIKSFLQEESYDIIDVTDINSDFIDNTLAVAKAVNEAEGRLGIMVDAYGAGPFMVATKLKGMVA 80 
195977594   1 MAIILGADAHGNELKEVLKSFLQQEGFDVTDVTDIDKDFIDNTLAVAQAVNDKDTNLGIMVDAYGAGPFMVATKLKGMIA 80 
209559828   1 MAIILGADAHGNALKELIKSFLQEEGYDIIDVTDINSDFIDNTLAVAKAVNEAEGRLGIMVDAYGAGPFMVATKLKGMVA 80 
225869950   1 MTIILGADAHGNDLKEAIKGFLQQEGFDVTDVTAIADDFVDNTLAVARALKADEESLGIMIDAYGAGPFMVATKIKGMVA 80 
225869098   1 MAIILGADAHGNELKEVLKGFLQQEGFDVTDVTDIDKDFIDNTLAVAQAVNDKDTNLGIMVDAYGAGPFMVATKLKGMIA 80 
94994907   81 AEVSDERSAYMTRGHNNARMITIGAEIVGPELAKNIVKGFVTGPYDGGRHQIRVDMLNKMA 141
94989030   81 AEVSDERSAYMTRGHNNARMITMGAEIVGPELAKNIAKGFVTGHYDGGRHQIRVDMLNKMA 141
19746613   81 AEVSDERSAYMTRGHNNARMITMGAEIVGPELAKNIAKGFVTGPYDGGRHQIRVDMLNKMA 141
94992920   81 AEVSDERSAYMTRGHNNARMITMGAEIVGPELAKNIAKGFVTGHYDGGRHQIRVDMLNKMA 141
71911211   81 AEVSDERSAYMTRGHNNARMITIGAEIVGPELAKNIVKGFVTGPYDGGRHQIRVDMLNKMA 141
139473267  81 AEVSDERSAYMTRGHNNARMITMGAEIVGPELAKNIAKGFVTGHYDGGRHQIRVDMLNKMA 141
195977594  81 AEVSDERSAYMTRGHNNARMITLGARIVGEELAKNIAKAFVVGSYDGGRHQIRVDMLNKMA 141
209559828  81 AEVSDERSAYMTRGHNNARMITIGAEIVGPELAKNIVKGFVTGPYDGGRHQIRVDMLNKMA 141
225869950  81 AEVSDERSAYMTRGHNNARMITMGAEIVGQELAKNIAKGFVTGHYDGGRHQIRVDMLNKMA 141
225869098  81 AEVSDERSAYMTRGHNNARMMTMGAEIVGQELAKNIAKGFVTGHYDGGRHQIRVDMLNKMA 141
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap