Conserved Protein Domain Family
PRK12596

?
PRK12596: PRK12596 
putative monovalent cation/H+ antiporter subunit E; Reviewed
Statistics
?
PSSM-Id: 105779
View PSSM: PRK12596
Aligned: 11 rows
Threshold Bit Score: 308.44
Threshold Setting Gi: 153010855
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
17989112    1 MKKILPYPLLFVSLVLFWLLLNSFTRAQFILGLVIAFGACRVMMALEPQKNHIRSPRMMIWLLYAASIDVLRSNIAVVRL 80 
23500250    1 MKKILPYPLLFVSLVLFWLLLNSFTRAQFILGLVIAFGACRVMMALEPQKNHIRSPRMMIWLLYAASIDVLRSNIAVVRL 80 
62317633    1 MKKILPYPLLFVSLVLFWLLLNSFTRAQFILGLVIAFGACRVMMALEPQKNHIRSPRMMIWLLYAASIDVLRSNIAVVRL 80 
83269616    1 MKKILPYPLLFVSLVLFWLLLNSFTRAQFILGLVIAFGACRVMMALEPQKNHIRSPRMMIWLLYAASIDVLRSNIAVVRL 80 
148558073   1 MKKILPYPLLFVSLVLFWLLLNSFTRAQFILGLVIAFGACRVMMALEPQKNHIRSPRMMIWLLYAASIDVLRSNIAVVRL 80 
163844664   1 MKKILPYPLLFVSLVLFWLLLNSFTRAQFILGLVIAFGACRVMMALESQKNHIRSPRMMIWLLYAASIDVLRSNIAVVRL 80 
161620567   1 MKKILPYPLLFVSLVLFWLLLNSFTRAQFILGLVIAFGACRVMMALEPQKNHIRSPRMMIWLLYAASIDVLRSNIAVVRL 80 
153010855   1 MKKILPYPLLFASLLLFWLLLNGFTRAQLLLGAIIALVACLIMTALQPQKNHIRSIPTMLLLFGTMSYDILQSNIAVAGI 80 
189022884   1 MKKILPYPLLFVSLVLFWLLLNSFTRAQFILGLVIAFGACRVMMALEPQKNHIRSPRMMIWLLYAASIDVLRSNIAVVRL 80 
225686299   1 MKKILPYPLLFVSLVLFWLLLNSFTRAQFILGLVIAFGACRVMMALEPQKNHIRSPRMMIWLLYAASIDVLRSNIAVVRL 80 
256015283   1 MKKILPYPLLFVSLVLFWLLLNSFTRAQFILGLVIAFGACRVMMALEPQKNHIRSPRMMIWLLYAASIDVLRSNIAVVRL 80 
17989112   81 ILSPGRQRHPGFVVIPLELQNRTALAVLACMITASPGTAWVDYNAARGILTIHVLDLEDAETWRHLIKERYERPLIEIFG 160
23500250   81 ILSPGRQRHPGFVVIPLELQNRTALAVLACMITASPGTAWVDYNAARGILTIHVLDLEDAETWRHLIKERYERPLIEIFG 160
62317633   81 ILSPGRQRHPGFVVIPLELQNRTALAVLACMITASPGTAWVDYNAARGILTIHVLDLEDAETWRHLIKERYERPLIEIFG 160
83269616   81 ILSPGRQRHPGFVVIPLELQNRTALAVLACMITASPGTAWVDYNAARGILTIHVLDLEDAETWRHLIKERYERPLIEIFG 160
148558073  81 ILSPGRQRHPGFVVIPLELQNRTALAVLACMITASPGTAWVDYNAARGILTIHVLDLEDAETWRHLIKERYERPLIEIFG 160
163844664  81 ILSPGRQRHPGFVVIPLELQNRTALAVLACMITASPGTAWVDYNAARGILTIHVLDLEDAETWRHLIKERYERPLIEIFG 160
161620567  81 ILSPGRQRHPGFVVIPLELQNRTALAVLACMITASPGTAWVDYNAARGILTIHVLDLEDAETWRHLIKERYERPLIEIFG 160
153010855  81 ILSRKRKRRPGFVVIQLDLENRTALAVLACIITATPGTAWVDYNAARHELTIHVLDLDDAQAWRDTIKGRYEQPLIKIFG 160
189022884  81 ILSPGRQRHPGFVVIPLELQNRTALAVLACMITASPGTAWVDYNAARGILTIHVLDLEDAETWRHLIKERYERPLIEIFG 160
225686299  81 ILSPGRQRHPGFVVIPLELQNRTALAVLACMITASPGTAWVDYNAARGILTIHVLDLEDAETWRHLIKERYERPLIEIFG 160
256015283  81 ILSPGRQRHPGFVVIPLELQNRTALAVLACMITASPGTAWVDYNAARGILTIHVLDLEDAETWRHLIKERYERPLIEIFG 160
17989112  161 VVDIVEGEKSA 171
23500250  161 AVDIVEGEKSA 171
62317633  161 AVDIVEGEKSA 171
83269616  161 AVDIVEGEKSA 171
148558073 161 AVDIVEGEKSA 171
163844664 161 AVDIVEGEKTA 171
161620567 161 AVDIVEGEKSA 171
153010855 161 AADVMEEEKSA 171
189022884 161 AVDIVEGEKSA 171
225686299 161 VVDIVEGEKSA 171
256015283 161 AVDIVEGEKSA 171
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap