Conserved Protein Domain Family
PRK12575

?
PRK12575: PRK12575 
succinate dehydrogenase/fumarate reductase iron-sulfur subunit
Statistics
?
PSSM-Id: 171592
View PSSM: PRK12575
Aligned: 15 rows
Threshold Bit Score: 479.069
Threshold Setting Gi: 134291237
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
134291237   1 MNDPRTLHIYRYDPDPDpdAAPYMQRYEIDVSADDRMLLDVLGRLKHDDETLSYRRSCREGICGSDAMNINGKNGLACLT 80 
53723280    1 MADTRILDIYRYDPDDG--RAPRMQRYELAPRAEDRMLLDVLGRVKAQDETLSYRRSCREGVCGSDAMNINGRNGLACVT 78 
107022875   1 MSDPRTLHIYRYDPDRD--AAPYMQRYEIDVNPDDRMLLDVLGRVKCDDETLSYRRSCREGICGSDAMNINGKNGLACLT 78 
116686882   1 MSDPRTLHIYRYDPDRD--AAPYMQRYEIDVNPDDRMLLDVLGRVKCDDETLSYRRSCREGICGSDAMNINGKNGLACLT 78 
124383037   3 MADTRILDIYRYDPDDG--RAPRMQRYELAPRAEDRMLLDVLGRVKAQDETLSYRRSCREGVCGSDAMNINGRNGLACVT 80 
126442611   3 MADTRILDIYRYDPDDG--RAPRMQRYELAPRAEDRMLLDVLGRVKAQDETLSYRRSCREGVCGSDAMNINGRNGLACVT 80 
126445717   3 MADTRILDIYRYDPDDG--RAPRMQRYELAPRAEDRMLLDVLGRVKAQDETLSYRRSCREGVCGSDAMNINGRNGLACVT 80 
121597494   1 MADTRILDIYRYDPDDG--RAPRMQRYELAPRAEDRMLLDVLGRVKAQDETLSYRRSCREGVCGSDAMNINGRNGLACVT 78 
161522531   2 DDDTRILHIYRYDPDRD--AAPYMQRYEITVQPDDRMLLDVLGRLKREDETLSYRRSCREGICGSDAMNINGSNGLACLT 79 
170734597   1 MSDPRTLHIYRYDPDRD--AAPYMQRYEIDVNPDDRMLLDVLGRVKCDDETLSYRRSCREGICGSDAMNINGKNGLACLT 78 
134291237  81 NMKTLPREIVLRPLPGLPVVRDLIVDMTDFFNQYHSIRPYQINDTTPPERERLQTPEERDQLDGLYECILCACCSTSCPS 160
53723280   79 SMQALPREIVLRPLPGLPVVRDLIVDMTSFFNQYHSVRPYLVNEGVPPERERLQTPQEREQLDGLYECILCACCSSACPS 158
107022875  79 NMQTLPREIVLRPLPGLPVVRDLIVDMTDFFNQYHSIRPYLINDTTPPARERLQSPEERDQLDGLYECILCACCSTSCPS 158
116686882  79 NMQTLPREIVLRPLPGLPVVRDLIVDMTDFFNQYHSIRPYLINDTTPPARERLQSPEERDQLDGLYECILCACCSTSCPS 158
124383037  81 SMQALPREIVLRPLPGLPVVRDLIVDMTSFFNQYHSVRPYLVNEGVPPERERLQTPQEREQLDGLYECILCACCSSACPS 160
126442611  81 SMQALPREIVLRPLPGLPVVRDLIVDMTSFFNQYHSVRPYLVNEGVPPERERLQTPQEREQLDGLYECILCACCSSACPS 160
126445717  81 SMQALPREIVLRPLPGLPVVRDLIVDMTSFFNQYHSVRPYLVNEGVPPERERLQTPQEREQLDGLYECILCACCSSACPS 160
121597494  79 SMQALPREIVLRPLPGLPVVRDLIVDMTSFFNQYHSVRPYLVNEGVPPERERLQTPQEREQLDGLYECILCACCSSACPS 158
161522531  80 NMKTLPREITLRPLPGLPVVRDLIVDMTDFFNQYHSIKPYLINDTPPPERERLQSPAERDQLDGLYECILCACCSTQCPT 159
170734597  79 NMQTLPREIVLRPLPGLPVVRDLIVDMTDFFNQYHSIRPYLINDTTPPARERLQSPEERDQLDGLYECILCACCSTSCPS 158
134291237 161 YWWNPDKFVGPAGLLQAYRFIADSRDMATAERLDNLEDPYRLFRCRTIMNCTDVCPKGLNPTKAISEIRTMLVRRTV 237
53723280  159 YWWNPDKFVGPAGLLQAYRFIVDSRDDASAARLDDLEDPYRLFRCRTIMNCVDVCPKGLNPARAIGQIRTMLARRAV 235
107022875 159 YWWNPDKFVGPAGLLQAYRFIADSRDLATAERLDDLEDPYRLFRCRTIMNCTDVCPKGLNPTKAISEIRTMLVRRTV 235
116686882 159 YWWNPDKFVGPAGLLQAYRFIADSRDLATAERLDDLEDPYRLFRCRTIMNCTDVCPKGLNPTKAISEIRTMLVRRTV 235
124383037 161 YWWNPDKFVGPAGLLQAYRFIVDSRDDASAARLDDLEDPYRLFRCRTIMNCVDVCPKGLNPARAIGQIRTMLARRAV 237
126442611 161 YWWNPDKFVGPAGLLQAYRFIVDSRDDASAARLDDLEDPYRLFRCRTIMNCVDVCPKGLNPARAIGQIRTMLARRAV 237
126445717 161 YWWNPDKFVGPAGLLQAYRFIVDSRDDASAARLDDLEDPYRLFRCRTIMNCVDVCPKGLNPARAIGQIRTMLARRAV 237
121597494 159 YWWNPDKFVGPAGLLQAYRFIVDSRDDASAARLDDLEDPYRLFRCRTIMNCVDVCPKGLNPARAIGQIRTMLARRAV 235
161522531 160 FWWNPDKFVGPAGLLQAYRFIADSRDLATGERLDNLEDPYRLFRCRTIMNCTSVCPKGLNPARAISNIRAMLVRRAV 236
170734597 159 YWWNPDKFVGPAGLLQAYRFIADSRDLATAERLDDLEDPYRLFRCRTIMNCTDVCPKGLNPTKAISEIRTMLVRRTV 235
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap