Conserved Protein Domain Family
PRK12568

?
PRK12568: PRK12568 
glycogen branching enzyme; Provisional
Statistics
?
PSSM-Id: 139075
View PSSM: PRK12568
Aligned: 9 rows
Threshold Bit Score: 1339.98
Threshold Setting Gi: 190574677
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
21229886    1 MAEGGGGSavALQDLQAIAAGLPGDAFAVLGPHVQADGRLRVRVLAPGAEALGLIDGRGKLLARMQASPIDGVFEGELPA 80 
84621722   17 VTTEGISE--MSQTLQALADGLPVDAFAVLGPHPLADGRRQVRVLAPGAEAMGLIDSRGKLLARMQASAIDGVFEGILSI 94 
78046008   17 MTTEGISE--TSQTLQALANGLPADAFAVLGPKPLAEGRRQVRVLAPGAEAMGLIDPRGKLLARMQASAIDGVFEGILAA 94 
122878984   1 MTTEGISE--MSQTLQALADGLPVDAFAVLGPHPLADGRRQVRVLAPGAEAMGLIDSRGKLLARMQASAIDGVFEGILSI 78 
66766764    1 MAEGGGGSavALQDLQAIAAGLPGDAFAVLGPHVQADGRLRVRVLAPGAEALGLIDGRGKLLARMQASPIDGVFEGELPA 80 
77748524    1 MTTEGISE--MSQTLQALADGLPADAFAVLGPKLLADGRRQVRVLAPGAEAMGLIDPRGKLLARMQASAIDGVFEGTLAV 78 
188574381   1 MTTEGISE--MSQTLQALADGLPVDAFAVLGPHPLADGRRQVRVLAPGAEAMGLIDSRGKLLARMQASAIDGVFEGILSI 78 
188989837  16 MAEGGGGSavALQDLQAIAAGLPGDAFAVLGPHVQADGRLRVRVLAPGAEALGLIDGRGKLLARMQASPIDGVFEGELPA 95 
190574677  16 MATAGREEgvVAPVLDDLVHARPADAFAWLGPHQQPDGQRQLRVLVPHARRVEVIAGPERRWD-LQPGPLPGLFEGAAGE 94 
21229886   81 DAAYRLRIVWPDVVQEIEDPYAFAPQIDESALLQIGAGDGQALRANLGARHVQVGELPAVRFAVWAPHAQRVAVVGDFNG 160
84621722   95 EGPYRLRIVWPDMVQEIEDPYAFAVTLDESLLLQIAAGDGQALRRALGAQHVQCGEVPGVRFAVWAPHAQRVAVVGDFNG 174
78046008   95 DGPYRLRIVWPDRVQEVEDPYAFAATLDESLLLQIAAGDGQAVRRALGAQHVHCGDVPGVRFAVWAPHAQRVAVVGDFNG 174
122878984  79 EGPYRLRIVWPDMVQEIEDPYAFAVTLDESLLLQIAAGDGQALRRALGAQHVQCGEVPGVRFAVWAPHAQRVAVVGDFNG 158
66766764   81 DAAYRLRIVWPDVVQEIEDPYAFAPQIDESALLQIGAGDGQALRANLGARHVQVGELPAVRFAVWAPHAQRVAVVGDFNG 160
77748524   79 DGPYRLRIVWPDRVQEVEDPYAFAATLDESLLLQIAAGDGQALRRALGAQHLHCGDVPGVRFALWAPHAQRVAVVGDFNG 158
188574381  79 EGPYRLRIVWPDMVQKIEDPYAFAVTLDESLLLQIAAGDGQALRRALGAQHVQCGEVPGVRFAVWAPHAQRVAVVGDFNG 158
188989837  96 EAAYRLRIVWPDVVQEIEDPYAFAPQIDESALLQIAAGDGQALRANLGARHVQVGEVPTVRFAVWAPHAQRVAVVGDFNG 175
190574677  95 APVPLLALHFEQGVEQVHDAYSFGPLLDEALLQHFHAGDADAARQ-LGAVAMQVQGIDGVRFAVWAPNARRVAVVGDFNG 173
21229886  161 WEPRRHPMRQR-SGGIWELVLPRVETGARYKYAIITADGRVLL-KADPVARQSELPPATASVVASADAFAWTDAEWMARR 238
84621722  175 WDVRRHPMRQR-IGGFWELFLPRVEAGPRYKYAVTAADGRVLL-KADPVARQTELPPATASVVPGTDTFAWTDAAWMAKR 252
78046008  175 WDVRRHPMRQR-IGGFWELFLPRVEAGARYKYAVTAADGRVLL-KADPVARQTELPPATASVVPSAAAFAWTDAAWMANR 252
122878984 159 WDVRRHPMRQR-IGGFWELFLPRVEAGPRYKYAVTAADGRVLL-KADPVARQTELPPATASVVPGTDTFAWTDAAWMAKR 236
66766764  161 WEPRRHPMRQR-SGGIWELVLPRVETGARYKYAIITADGRVLL-KADPVARQSELPPATASVVASADAFAWTDAEWMARR 238
77748524  159 WDVRRHPMRQR-IGGFWELFLPRVDAGARYKYAVTAADGRVLL-KADPVARQTELPPATASVVPSAATFAWTDAAWMANR 236
188574381 159 WDVRRHPMRQR-IGGFWELFLPRVEAGPRYKYAVTAADGRVLL-KADPVARQTELPPATASVVPGTATFAWTDAAWMAKR 236
188989837 176 WEPRRHPMRQR-SGGIWELVLPRVETGARYKYAITTADGRVLL-KADPVARQSELPPATASVVASADAFAWTDAEWMARR 253
190574677 174 WDGRRHPMRLRhTAGVWELFLPGVQAGARYKFRIVGADGRVMPdKFDPMARWAELPPATASRVPSAAPMQWHDDAWLAAR 253
21229886  239 SAAAEPAPLSIYEVHAASWRRDGHDQPLDWVSLAAQLIPYVQELGFTHIELLPITEHPFGGSWGYQPLGLYAPTARHGSP 318
84621722  253 DPSAVPAPLSIYEVHAASWRRDGHNQPLDWPTLAEQLIPYVQQLRFTHIELLPITEHPFGGSWGYQPLGLYAPTARHGSP 332
78046008  253 DPGAVPAPLSIYEVHAASWRRDGHNQPLDWPTLAEQLIPYVQQLGFTHIELLPITEHPFGGSWGYQPLGLYAPTARHGSP 332
122878984 237 DPSAVPAPLSIYEVHAASWRRDGHNQPLDWPTLAEQLIPYVQQLRFTHIELLPITEHPFGGSWGYQPLGLYAPTARHGSP 316
66766764  239 SAAAEPAPLSIYEVHAASWRRDGHDQPLDWVSLAAQLIPYVQELGFTHIELLPITEHPFGGSWGYQPLGLYAPTARHGSP 318
77748524  237 DPAAVPGPLSIYEVHAASWRRDGHNQPLDWPTLAEQLIPYVQQLGFTHIELLPITEHPFGGSWGYQPLGLYAPTARHGSP 316
188574381 237 DPSAVPAPLSIYEVHAASWRRDGHNQPLDWPTLAEQLIPYVQQLRFTHIELLPITEHPFGGSWGYQPLGLYAPTARHGSP 316
188989837 254 SAAAEPAPLSIYEVHAASWRRDGHDQPLDWVSLAAQLIPYVQELGFTHIELLPITEHPFGGSWGYQPLGLYAPTARHGSP 333
190574677 254 RQAGTCTPLSIYEVHAGSWQRSDDGSPLDWDVLADRLIPYVAGLGFTHIELLPVSEHPFGGSWGYQPLGIYAPTARHGTP 333
21229886  319 DGFAQFVDACHRAGIGVILDWVSAHFPDDAHGLSQFDGSATYEHADPREGMHRDWNTLIYNYGRPEVTAYLLGSAMEWIA 398
84621722  333 DGFAQFVDACHRAGIGVILDWVSAHFPDDAHGLAQFDGAALYEHADPREGMHRDWNTLIYNYGRPEVTAYLLGSALEWID 412
78046008  333 DGFAQFVDACHRAGIGVILDWVSAHFPDDAHGLAQFDGAALYEHADPREGMHRDWNTLIYNYGRPEVTAYLLGSALEWIE 412
122878984 317 DGFAQFVDACHRAGIGVILDWVSAHFPDDAHGLAQFDGAALYEHADPREGMHRDWNTLIYNYGRPEVTAYLLGSALEWID 396
66766764  319 DGFAQFVDACHRAGIGVILDWVSAHFPDDAHGLSQFDGSATYEHADPREGMHRDWNTLIYNYGRPEVTAYLLGSAMEWIA 398
77748524  317 DGFAQFVDACHRAGIGVILDWVSAHFPDDAHGLAQFDGAALYEHADPREGMHRDWNTLIYNYGRPEVTAYLLGSALEWIE 396
188574381 317 DGFAQFVDACHRAGIGVILDWVSAHFPDDAHGLAQFDGAALYEHADPREGMHRDWNTLIYNYGRPEVTAYLLGSALEWID 396
188989837 334 DGFAQFVDACHRAGIGVILDWVSAHFPDDAHGLSQFDGSATYEHADPREGMHRDWNTLIYNYGRPEVTAYLLGSAMEWIA 413
190574677 334 QAFARFVDRCHQAGIGVIVDWVSAHFPNDAHGLAGFDGTALYEHADPREGVHADWDTLIYNYGRNEVAAYLIGSALEWVE 413
21229886  399 HYHLDGLRVDAVASMLYRDYGRAEGEWVPNAHGGRENLEAVAFLRQLTGEIASQFPGVLTIAEESTAWPGVTAPISEGGL 478
84621722  413 HYHLDGLRVDAVASMLYRDYGRAEGEWVPNAHGGRENLEAVAFLRQLNREIAAHFPGVLTIAEESTAWPGVTAAISDGGL 492
78046008  413 HYHLDGLRVDAVASMLYRDYGRAEGEWVPNAHGGRENLEAVAFLRQLNREIATQFPGVLTIAEESTAWPGVTAAISDGGL 492
122878984 397 HYHLDGLRVDAVASMLYRDYGRAEGEWVPNAHGGRENLEAVAFLRQLNREIAAHFPGVLTIAEESTAWPGVTAAISDGGL 476
66766764  399 HYHLDGLRVDAVASMLYRDYGRAEGEWVPNAHGGRENLEAVAFLRQLTGEIASQFPGVLTIAEESTAWPGVTAPISEGGL 478
77748524  397 HYHLDGLRVDAVASMLYRDYGRAEGEWVPNAHGGRENLEAVAFLRQLNRDIATQFPGVLTIAEESTAWPGVTAAISDGGL 476
188574381 397 HYHLDGLRVDAVASMLYRDYGRAEGEWVPNAHGGRENLEAVAFLRQLNREIAAHFPGVLTIAEESTAWPGVTAAISDGGL 476
188989837 414 HYHLDGLRVDAVASMLYRDYGRAEGEWVPNAHGGRENLEAVAFLRQLTGEIASQFPGVLTIAEESTAWPGVTAPISEGGL 493
190574677 414 RFHIDGLRVDAVASMLYRDYSRAEGQWIPNEQGGRENLQAVAFLRRMNQTLRERFPDVLVIAEESTAWPGVTAPVEQGGL 493
21229886  479 GFTHKWNMGWMHDTLHYMQRDPAARAQHHSQLTFGLVYAFSERFVLPLSHDEVVHGTGGLLGQMPGDDWRRFANLRAYLA 558
84621722  493 GFTHKWNMGWMHDTLSYMQRDPAERAHHHSQLTFGLVYAFDERFVLPISHDEVVHGTGGLLGQMPGDDWRRFANLRAYLA 572
78046008  493 GFTHKWNMGWMHDTLGYMQRDPAERAQHHSQLTFGLVYAFDERFVLPLSHDEVVHGTGGLLGQMPGDDWRRFANLRAYLA 572
122878984 477 GFTHKWNMGWMHDTLSYMQRDPAERAHHHSQLTFGLVYAFDERFVLPISHDEVVHGTGGLLGQMPGDDWRRFANLRAYLA 556
66766764  479 GFTHKWNMGWMHDTLHYMQRDPAARAQHHSQLTFGLVYAFSERFVLPLSHDEVVHGTGGLLGQMPGDDWRRFANLRAYLA 558
77748524  477 GFTHKWNMGWMHDTLGYMQRDPAERAHHHSQLTFGLVYAFDERFVLPLSHDEVVHGTGGLLGQMPGDDWRRFANLRAYLA 556
188574381 477 GFTHKWNMGWMHDTLSYMQRDPAERAHHHSQLTFGLVYAFDERFVLPISHDEVVHGTGGLLGQMPGDDWRRFANLRAYLA 556
188989837 494 GFTHKWNMGWMHDTLHYMQRDPAARAQHHSQLTFGLVYAFSERFVLPLSHDEVVHGTGGLLGQMPGDDWRRFANLRAYLA 573
190574677 494 GFTHKWNMGWMHDTLQYLGRDPVHRQHHHSEISFGLVYAFSERFVLPLSHDEVVHGKGALLAKMAGEPVQRLAQLRAYYG 573
21229886  559 LMWAHPGDKLLFMGAEFGQWADWNHDRSLDWHLLDHAPHRGMQQLVRDLNRALRRVPALYRGNHRADGFEWSVADDARNS 638
84621722  573 LMWAHPGDKLLFMGAEFGQWADWNHDQSLDWHLLEGARHRGVQLLVGDLNATLRRTPALYRGTHRAKGFDWSVADDARNS 652
78046008  573 LMWAHPGDKLLFMGAEFGQWADWNHDQSLDWHLLDGARHRGMQQLVGDLNAALRRTPALYRGSHRADGFDWSVADDARNS 652
122878984 557 LMWAHPGDKLLFMGAEFGQWADWNHDQSLDWHLLEGARHRGVQLLVGDLNATLRRTPALYRGTHRAKGFDWSVADDARNS 636
66766764  559 LMWAHPGDKLLFMGAEFGQWADWNHDRSLDWHLLDHAPHRGMQQLVRDLNRALRRVPALYRGNHRADGFEWSVADDARNS 638
77748524  557 LMWAHPGDKLLFMGAEFGQWADWNHDQSLDWHLLDGARHRGMQQLVGDLNAALRRTPALYRGTHRAEGFDWSVADDARNS 636
188574381 557 LMWAHPGDKLLFMGAEFGQWADWNHDQSLDWHLLEGARHRGVQLLVGDLNATLRRTPALYRGTHRAEGFDWSVADDARNS 636
188989837 574 LMWAHPGDKLLFMGAEFGQWADWNHDRSLDWHLLDHAPHRGMQQLVRDLNRALRRVPALYRGNHRADGFEWSVADDARNS 653
190574677 574 FMWAHPGSKLLFMGGEFGQGQEWSHDAALDWVQAASNEGQGLSRLVGDLNAVLRAEPALHRDERDERGFDWSVADDSRNS 653
21229886  639 VLAFIRHDPDGGA-PLLAVSNLTPQPHHDYRVGVPRAGGWREILNTDSAHYGGSNLGNGGRLLTEPTGMHGHAQSLRLTL 717
84621722  653 VLAFIRHDPDGGGvPLLAVSNLTAQPLHDYGVGVPRAGAWREILNTDSAHYGGSNLGNSGRLATEPMGMHGHAQRLRLTL 732
78046008  653 VLAFVRHDPAGGA-PLLAVSNLTPQPHHDYHVGVPRAGLWREILNTDSAHYGGSNLGNSGRLATEPVGMHGHAQRLRLTL 731
122878984 637 VLAFIRHDPDGGGvPLLAVSNLTAQPLHDYGVGVPRAGAWREILNTDSAHYGGSNLGNSGRLATEPMGMHGHAQRLRLTL 716
66766764  639 VLAFIRHDPDGGA-PLLAVSNLTPQPHHDYRVGVPRAGGWREILNTDSAHYGGSNLGNGGRLLTEPTGMHGHAQSLRLTL 717
77748524  637 VLAFVRHDPDGGA-PLLAVSNLTPQPHHDYHVGVPRAGLWREILNTDSAHYGGSNLGNSGRLATEPVGMHGHAQRLRLTL 715
188574381 637 VLAFIRHDPDGGGvPLLAVSNLTAQPLHDYGVGVPRAGAWREILNTDSAHYGGSNLGNSGRLATEPMGMHGHAQRLRLTL 716
188989837 654 VLAFIRHDPDGGA-PLLAVSNLTPQPHHDYRVGVPRAGGWREILNTDSAHYGGSNLGNGGRLLTEPTGMHGHAQSLRLTL 732
190574677 654 VYAFIRRDPAGSGrTLLVVSNFTPVRRDGYRVGVPQPGCWTERLNTDSGYYGGGNAGNLGAVHTEPRPMHGHAQSLRLTL 733
21229886  718 PPLATIYLQAEK 729
84621722  733 PPLATIYLQAEK 744
78046008  732 PPLATIYLQAEK 743
122878984 717 PPLATIYLQAEK 728
66766764  718 PPLATIYLQAEK 729
77748524  716 PPLATIYLQAEK 727
188574381 717 PPLATIYLQAEK 728
188989837 733 PPLATIYLQAEK 744
190574677 734 PPLSTLYLQVDA 745
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap