Conserved Protein Domain Family
PRK12566

?
PRK12566: PRK12566 
glycine dehydrogenase; Provisional
Statistics
?
PSSM-Id: 171585
View PSSM: PRK12566
Aligned: 13 rows
Threshold Bit Score: 1879.23
Threshold Setting Gi: 152987333
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
70733244     1 MLSLSQLREPNAFLNRHLGPDAEEQQAMLASLGLGSRAELIEQTVPPGIRFNRALDLPPALDEAAALARLKGYAGQNQVW 80  
104784212    4 SPSLSQLQEPNPFLRRHLGPDGPEQQAMLEALGVASRDALIEQTVPPGIRLNRPLDLPPALDEQAALDKLAGYAAQNQLW 83  
26991868     4 SPSLHQLQELNPFLRRHLGPDATEQQAMLNALGIASRNELIEQTVPPDIRLNRPLDLPAALDEQAALAKLAGYAEQNQVW 83  
15600406     4 TPSLAQLQPADAFLRRHLGPDPAEQQAMLAFLGVSTRAELIVQTVPPAIRLNRPLELPAALDEQAALARLRGYAGLNQRW 83  
77461647     4 LPSLSQLRDPHAFLRRHLGPDAAEQQAMLDSLGLGSRVELIEQTVPPGIRLNRELDLPPALDEQAALARLRGYAEQNQVW 83  
116053361    4 TPSLAQLQPADAFLRRHLGPDPAEQQAMLDFLGVSTRAELIVQTVPPAIRLNRPLELPAALDEQAALARLRGYAGLNQRW 83  
148550299    4 SPSLHQLQELNPFLRRHLGPDATEQQAMLNALGIASRNELIEQTVPPDIRLNRPLDLPAALDEQAALAKLAGYAEQNQVW 83  
146284374    4 MPSLSQLQQTDAFLRRHLGPDQGEQQAMLDALGLASREQLIEQTVPPAIRLQGELNLPPALDEQAALAKLKGYAEQNQLW 83  
152987333   46 TPSLAQLQPADAFLRRHLGPDPAEQQAMLDFLGVSTRAELIVQTVPPAIRLNRPLELPAALDEQAALARLRSYAELNQRW 125 
167036239    4 SPSLHQLQELNPFLRRHLGPDAAEQQAMLKVLGVASRNELIEQTVPPDIRLNRPLDLPAALDEQAALAKLAGYAEQNQVW 83  
170724174    4 SPSLHQLQELNPFLRRHLGPDASEQQAMLNALGLSSRSELIEQTVPPDIRFNRALDLPAALDEQAALAKLAGYAEQNQVW 83  
218894315    4 TPSLDQLQPADAFLRRHLGPDPAEQQAMLDFLGVSTRAELIVQTVPPAIRLNRPLELPAALDEQAALARLRGYAGLNQRW 83  
226946733    4 TPSLVQLQQPDAFLRRHLGPDAAEQRAMLASLGLASRDQLIEQTVPPAIRLNRALELPAALDERAALARLRGYAERNEPW 83  
70733244    81 TSLIGMGYHATLTPTVILRNVLENPGWYTAYTPYQPEIAQGRLEALLNFQQMTIDLTGLDLANASLLDEATAAAEAMALA 160 
104784212   84 TSLIGMGYHATVTPTVILRNVLENPGWYTAYTPYQPEIAQGRLEALLNFQQMVIDLTGLALANASLLDEATAAAEAMALA 163 
26991868    84 TSLIGMGYHGTITPTVILRNVLENPGWYTAYTPYQPEIAQGRLEALLNFQQMVIDLTGLPLANASLLDEATAAAEAMALA 163 
15600406    84 TSLIGMGYYGTVTPSVILRNVLENPGWYTAYTPYQPEIAQGRLEALLNFQQLTIDLTGLDLASASLLDEATAAAEAMALA 163 
77461647    84 TSLIGMGYHGTLTPTVILRNVLENPGWYTAYTPYQPEIAQGRLEALLNFQQLTIDLTGLELANASLLDEATAAAEAMALA 163 
116053361   84 TSLIGMGYYGTVTPPVILRNVLENPGWYTAYTPYQPEIAQGRLEALLNFQQLTIDLTGLDLASASLLDEATAAAEAMALA 163 
148550299   84 TSLIGMGYHGTITPTVILRNVLENPGWYTAYTPYQPEIAQGRLEALLNFQQMVIDLTGLPLANASLLDEATAAAEAMALA 163 
146284374   84 TSLIGMGYHGTITPPVILRNVLENPGWYTAYTPYQPEIAQGRLEALLNYQQMIIDLTGLDLANASLLDEATAAAEAMTLA 163 
152987333  126 TSLIGMGYHGTVTPPVILRNVLENPGWYTAYTPYQPEIAQGRLEALLNFQQLTIDLTGLDLASASLLDEATAAAEAMALA 205 
167036239   84 TSLIGMGYHGTITPTVILRNVLENPGWYTAYTPYQPEIAQGRLEALLNFQQMVIDLTGLALANASLLDEATAAAEAMALA 163 
170724174   84 TSLIGMGYHGTVTPTVILRNVLENPGWYTAYTPYQPEIAQGRLEALLNFQQMVIDLSGLALANASLLDEATAAAEAMALA 163 
218894315   84 TSLIGMGYYGTVTPSVILRNVLENPGWYTAYTPYQPEIAQGRLEALLNFQQLTIDLTGLDLASASLLDEATAAAEAMALA 163 
226946733   84 TSLIGMGYHGTVTPPVILRNVLENPGWYTAYTPYQPEIAQGRLEALLNFQQLTIDLTGLDLASASLLDEATAAAEAMAMA 163 
70733244   161 KRVSKSSSNLFFVDEHCHPQTVSVVRTRAEGFGFELVVGGVDELSGHQVFGALLQYPDTHGEIRDLRPLIDQLHAQQALA 240 
104784212  164 KRVARSKSNAFFADEHCHPQTLSVLKTRAEGFGFELIVDSVDNLARHKVFGALLQYPDTHGEVRDLRPLIDQLHGQQALA 243 
26991868   164 KRVARNKSNAFFADEHCHPQTLSVLKTRAEGFGFELIVDSVDNLAKHSVFGALLQYPDTHGEVRDLRPLIDQLHSQQALA 243 
15600406   164 RRVAKARSNRFFVDAHCHPQTVSVLRTRAEAFGFELVVDEPDNLAAHAVFGALLQYPDSRGEIRDLRPLIEALHGQQALA 243 
77461647   164 KRVAKSKSNLFFVDENCHPQTISVVQTRAEGFGFELIVDAVDNLKQHQVFGALLQYPDTHGEIRDLRPLIDHLHAQQALA 243 
116053361  164 RRVAKARSNRFFVDAHCHPQTVSVLRTRAEAFGFELVVDEPDNLAAHAVFGALLQYPDSRGEIRDLRPLIEALHGQQALA 243 
148550299  164 KRVARNKSNAFFADEHCHPQTLSVLKTRAEGFGFELIVDTVDNLAKHSVFGALLQYPDTHGEVRDLRPLIDQLHGQQALA 243 
146284374  164 RRMAKSKSNRFFVDENCHPQTLSVVQTRAEAFGFELVVGTLDDLAGHEVFGALLQYPDTHGEIRDLRPAIEQLHAQQALA 243 
152987333  206 RRVAKARSNRFFVDAHCHPQTVSVLRTRAEAFGFELVIDEPDNLATHAVFGALLQYPDSRGEIRDLRPLIDLLHGQQALA 285 
167036239  164 KRVARNKSNAFFADEHCHPQTLSVLKTRAEGFGFELIVDAVDNLANHAVFGALLQYPDTHGEVRDLRPLIDQLHSQQALA 243 
170724174  164 KRVARNKSNAFFADEHCHPQTLSVLQTRAEGFGFELIVDAVDNLAQHQVFGALLQYPDTHGEVRDLRPLIDQLHGQHALA 243 
218894315  164 RRVAKARSNRFFVDAHCHPQTVSVLRTRAEAFGFELVVDEPDNLAAHAVFGALLQYPDSRGEIRDLRPLIEALHGQQALA 243 
226946733  164 RRVARSRSNRFFVDENCHPQTLSVVRTRAAGFGFEVVVDAVENLSEHAVFGALLQYPDSHGEIRDLEPLIEQLHAQQALA 243 
70733244   241 CVAADLLSLLLLTPPGELGADVVLGSSQRFGVPMGYGGPHAAFFACRDDYKRAMPGRIIGVSKDARGQVALRMALQTREQ 320 
104784212  244 CMAADILSLVVLTPPGELGADVVLGSTQRFGVPMGYGGPHAAYFACRDDFKRAMPGRIIGVSRDARGNTALRMALQTREQ 323 
26991868   244 CVAADLLSLVVLAPPGELGADVVLGSTQRFGVPMGYGGPHAAYFACRDDYKRAMPGRIIGVSRDARGNTALRMALQTREQ 323 
15600406   244 CVASDLLALLLLTPPGELGADVVLGSAQRFGVPMGYGGPHAAFFATREGYKRAMPGRIIGVSRDARGNPALRMALQTREQ 323 
77461647   244 CVAADLLSLLLLTPPGELGADVVFGSSQRFGVPMGYGGPHAAVFASREEYKRAIPGRIIGVSKDARGNVALRMALQTREQ 323 
116053361  244 CVASDLLALLVLTPPGELGADVVLGSAQRFGVPMGYGGPHAAFFATREGYKRAMPGRIIGVSRDARGNPALRMALQTREQ 323 
148550299  244 CVAADLLSLVVLAPPGELGADVVLGSTQRFGVPMGYGGPHAAYFACRDDYKRAMPGRIIGVSRDARGNTALRMALQTREQ 323 
146284374  244 CVAADLLSLLLLTPPGELGADVVLGSTQRFGVPMGYGGPHAAYFASRDEFKRGMPGRIIGVSKDARGNTALRMALQTREQ 323 
152987333  286 CVASDLLALLLLTPPGELGADVVLGSAQRFGVPMGYGGPHAAFFATRDAYKRAMPGRIIGVSRDARGNPALRMALQTREQ 365 
167036239  244 CVAADLLSLVVLAPPGELGADVVLGSTQRFGVPMGYGGPHAAYFACRDDYKRAMPGRIIGVSRDARGNTALRMALQTREQ 323 
170724174  244 CVAADLLSLVVLTPPGELGADVVLGSTQRFGVPMGYGGPHAAYFACREDYKRAMPGRIIGVSRDARGNTALRMALQTREQ 323 
218894315  244 CVASDLLALLLLTPPGELGADVVLGSAQRFGVPMGYGGPHAAFFATREGYKRAMPGRIIGVSRDARGNPALRMALQTREQ 323 
226946733  244 CVAADLLALLVLTPPGELGADVVLGSAQRFGVPMGYGGPHAAYFATRDEFKRAMPGRIIGVSRDARGNTALRMALQTREQ 323 
70733244   321 HIRREKANSNICTAQVLLANIAGFYAVYHGPAGLKRIAQRVHRLTCILAVGLERHGIARVNRHFFDTLTLEVGGSQTAII 400 
104784212  324 HIRREKANSNICTAQVLLANIAGFYAVYHGPEGLQRIAQRVHRLTFILAAGLEAKGIKRLNQHFFDTLTLDVGGTQAAII 403 
26991868   324 HIRREKANSNICTAQVLLANIAGFYAVYHGPEGLQRIAQRVHRLTFILAAGLEAKGIKRLNQHFFDTLTLNVGGAQAAII 403 
15600406   324 HIRREKANSNICTAQVLLANIASLYAVYHGPQELKRIAQRVQRLTALLAAGLKSKGLRRLNRHFFDTLTYEVGERQAAIL 403 
77461647   324 HIRREKANSNICTAQVLLANIASFYAVYHGPEGLKRIAQRVHRLTCILAAGLERHGIQRLNQHFFDTLTLDVGGAQTAII 403 
116053361  324 HIRREKANSNICTAQVLLANIASLYAVYHGPQELKRIAQRVQRLTALLAAGLESKGLRRLNRHFFDTLTYEVGERQAAIL 403 
148550299  324 HIRREKANSNICTAQVLLANIAGFYAVYHGPEGLQRIAQRVHRLTFILAAGLEAKGIKRLNQHFFDTLTLNVGGAQAAII 403 
146284374  324 HIRREKANSNICTAQVLLANIAGFYAVYHGPQGLKRIAQRVHRLTAILAAGLEQKGIVRLNRHFFDTLTLEVGGAQTAII 403 
152987333  366 HIRREKANSNICTAQVLLANIASLYAVYHGPQELKRIAQRVQRLAALLAAGLESKGLRRLNRYFFDTLTYEVGERQPAIL 445 
167036239  324 HIRREKANSNICTAQVLLANIAGFYAVYHGPEGLQRIAQRVHRLTFILAAGLEAKGIKRLNQHFFDTLTLDVGGAQAAII 403 
170724174  324 HIRREKANSNICTAQVLLANIAGFYAVYHGPEGLQRIAQRVHRLTVVLAAGLEAKGIKRLNQHFFDTLTLDVGGAQAAII 403 
218894315  324 HIRREKANSNICTAQVLLANIASLYAVYHGPQELKRIAQRVQRLTALLAAGLESKGLRRLNRHFFDTLTYEVGERQAAIL 403 
226946733  324 HIRREKANSNICTSQVLLANMAGFYAVYHGPEGLERIARRVHRLTAILAEGLAQRGIERLNRHFFDTLTLEVGGAQTAII 403 
70733244   401 ESARAQQINLRILGRGRLGLSLDETCDESTVTRLFDVFLGADHGLDVSNLDAEALESGIPDPLLRRTRYLTHPVFSAHHS 480 
104784212  404 TSAEEARINLRILGRGHLGVSLDETCNEATVYKLFDIFLGVDHGLDITELDQKALPEGIPGALVRRTPILQHPVFNLHHS 483 
26991868   404 ESAEAAHINLRILGRGHLGVSLDETCTEQTVLRLLDIFLGVDHGLEITALDQLALPEGIPASLVRRTPFLAHPVFNLHHS 483 
15600406   404 ERARAARVNLRVVDDRRLALSLDETCDAATLATLFEIFLGAGHGLDVAHLDGGAVADGIPAVLQRTSAYLQHPVFNAHHS 483 
77461647   404 ESAQAAQINLRILGRGQLGLSLDEACDENTVARLFDVLLGADHGLSIDDLDAETLASGIPEMLQRSTSYLRHPVFNAHHS 483 
116053361  404 ERARAARVNLRVVDDRRLALSLDETCDAATLATLFEIFLGAGHGLDVAHLDGGAVADGIPAVLQRTSAYLQHPVFNAHHS 483 
148550299  404 ESAEAAHINLRILGRGHLGVSLDETCNEQTVLRLLDIFLGVDHGLEITALDQLALPEGIPASLVRRTPFLAHPVFNLHHS 483 
146284374  404 ESAEAAQINLRILGRGRLGVSLDETCDERTVEQLLAIFLGADHGLDVAALDAGELAAGIPAGLQRDSGYLEHPVFNSHHS 483 
152987333  446 ERARAARVNLRVVDDRRLALSLDETCDAATLASLFEIFLGAGHGLEVERLDAGVVADGIPAVLQRTSAYLLHPVFNAHHS 525 
167036239  404 ESAEAAHINLRILGRGHLGVSLDETCNEHTVLRLLDIFLGVDHGLEIAALDQLALPEGIPASLVRRTPLLAHPVFNLHHS 483 
170724174  404 ESAQAACINLRILGRGHLGVSLDETCSEETVLRLFDIFLGVDHGLEVTTLDQHAVVEGIPAALERRTPFLSHPVFNLHHS 483 
218894315  404 ERARAARVNLRVVDDRRLALSLDETCDAATLATLFEIFLGAGHGLDVAHLDGGAVADGIPAVLQRTSAYLQHPVFNAHHS 483 
226946733  404 ESAKEARINLRILGRGRLGVSLDETCTAETVERLLAIFLGADHGLDLATLDDAA-ASGIPAALQRTSAYLRHPVFNSHHS 482 
70733244   481 ETEMLRYLKQLENKDLALNQSMIPLGSCTMKLNASSEMIPITWPEFANLHPFAPREQAAGYGLLIAELERWLCAITGFDA 560 
104784212  484 ETEMLRYLKQLENKDLALNQSMIPLGSCTMKLNATSEMIPITWPAFSQPHPFAPLTQMQGYKAMIDELERWLCAITGFDA 563 
26991868   484 ETEMLRYLKQLENKDLALNQSMIPLGSCTMKLNATSEMIPITWPGFAQLHPFAPAAQAAGYKAMIDELESWLCAITGFDA 563 
15600406   484 ETEMLRYLRQLEGKDLALNQAMIPLGSCTMKLNASSEMIPITWPEFAELHPFVPREQAEGYRRMIDELEAWLRAITGFDA 563 
77461647   484 ETEMLRYLKQLENKDLALNQSMIPLGSCTMKLNATSEMIPITWPQFANLHPFVPREQAVGYTLMIEELERWLCAITGFDA 563 
116053361  484 ETEMLRYLRQLEGKDLALNQAMIPLGSCTMKLNASSEMIPITWPEFAELHPFVPREQAEGYRRMIDELEAWLRAITGFDA 563 
148550299  484 ETEMLRYLKQLENKDLALNQSMIPLGSCTMKLNATSEMIPITWSGFAQLHPFAPAAQAAGYKAMIDELESWLCAITGFDA 563 
146284374  484 ETEMLRYLKQLENKDLALNQAMIPLGSCTMKLNATSEMIPITWAEFANLHPFVPRGQAQGYRLMIEELEAWLCAITGFDA 563 
152987333  526 ETEMLRYLRQLEGKDLALNQAMIPLGSCTMKLNASSEMIPITWPEFAELHPFVPREQAEGYRRMIDELEAWLRAITGFDA 605 
167036239  484 ETEMLRYLKQLENKDLALNQSMIPLGSCTMKLNATSEMIPITWPGFAHLHPFAPASQASGYKAMIDELESWLCAITGFDA 563 
170724174  484 ETQMLRYLKQLENKDLALNQSMIPLGSCTMKLNATSEMIPITWPGFAQLHPFAPDAQVAGYKAMIDELECWLCAITGFDA 563 
218894315  484 ETEMLRYLRQLEGKDLALNQAMIPLGSCTMKLNASSEMIPITWPEFAELHPFVPREQAEGYRRMIDELEAWLRAITGFDA 563 
226946733  483 ETEMLRYLKQLERKDLALDQAMIPLGSCTMKLNATSEMLPVTWPEFADLHPFAPREQAEGYRLMIEELETWLCAITGFDA 562 
70733244   561 ICMQPNSGAQGEYAGLLAIRRYHESRRQGGRHVCLIPASAHGTNPASAQMAGMQVVIVECDEAGNVDLEDLKAKAQAAGE 640 
104784212  564 ICMQPNSGAQGEYAGLMAITRYHRSRHQARRTLCLIPSSAHGTNPASAQMAGMEVVIVECDEQGNIDFDDLKAKAQAAGD 643 
26991868   564 ICMQPNSGAQGEYAGLMAITRYHCSRHQPMRTLCLIPSSAHGTNPASAQMAGMEVVIVDCDNDGNVDLADLKAKAHAAGE 643 
15600406   564 ICMQPNSGAQGEYAGLLAIRRYHQSRGDSQRDICLIPASAHGTNPASAIMASMRVVIVECDPRGNVDLDDLRLKAAEAGD 643 
77461647   564 ICMQPNSGAQGEYAGLLAIRKYHESRQQGGRDICLIPSSAHGTNPASAQMAGMRVVIVECDDAGNVDLEDLKAKASEAGA 643 
116053361  564 ICMQPNSGAQGEYAGLLAIRRYHQSRGDSQRDICLIPASAHGTNPASAIMASMRVVIVECDPCGNVDLDDLRLKAAEAGD 643 
148550299  564 ICMQPNSGAQGEYAGLMAITRYHRSRHQPMRTLCLIPSSAHGTNPASAQMAGMDVVIVDCDNDGNVDLADLKAKAHAAGE 643 
146284374  564 ISMQPNSGAQGEYAGLVAIRKYHESRGEGQRDICLIPSSAHGTNPASAQMVSMRVVIVECDKGGNVDLEDLKRKAAEAGD 643 
152987333  606 ICMQPNSGAQGEYAGLLAIRRYHQSRGDSQRDICLIPASAHGTNPASAIMAGMRVEIVECDVRGNVDLDDLRLKAAEAGE 685 
167036239  564 ICMQPNSGAQGEYAGLMAITRYHRSRHQPQRTLCLIPSSAHGTNPASAQMAGMEVVIVDCDNDGNVDLADLKAKAHAAGE 643 
170724174  564 ICMQPNSGAQGEYAGLMAITRYHRSRHQPQRTLCLIPSSAHGTNPASAQMAGMEVVIVDCDDDGNVDLDDLKAKANAAGE 643 
218894315  564 ICMQPNSGAQGEYAGLLAIRRYHQSRGDSQRDICLIPASAHGTNPASAIMASMRVVIVECDPCGNVDLDDLRLKAAEAGD 643 
226946733  563 ICMQPNSGAQGEYAGLLAIRDYHRSRGEAQRNVCLIPSSAHGTNPASAQMAGMQVRIVDCDRSGNIDLADLRRKAEAAGD 642 
70733244   641 RLSCLMATYPSTHGVYEEGISQICEVIHSHGGQVYMDGANLNAQVGLARPADIGADVSHMNLHKTFCIPHGGGGPGMGPI 720 
104784212  644 RLSCLMVTYPSTHGVYEEGIREICEVVHQHGGQVYMDGANLNAQVGLTRPADIGADVSHMNLHKTFCIPHGGGGPGMGPI 723 
26991868   644 RLSCLMITYPSTHGVYEEGIREICDVVHQYGGQVYMDGANLNAQVGLARPADIGADVSHMNLHKTFCIPHGGGGPGMGPI 723 
15600406   644 RLSCLMITYPSTHGVYEEGIGEICEVVHRHGGQVYMDGANLNAQVGLARPADIGADVSHMNLHKTFCIPHGGGGPGMGPI 723 
77461647   644 KLSCLMATYPSTHGVYEEGISEICEVIHKHGGQVYMDGANLNAQVGLARPADIGADVSHMNLHKTFCIPHGGGGPGMGPI 723 
116053361  644 RLSCLMITYPSTHGVYEEGIGEICEVVHRHGGQVYMDGANLNAQVGLARPADIGADVSHMNLHKTFCIPHGGGGPGMGPI 723 
148550299  644 RLSCLMITYPSTHGVYEEGIREICDVVHQHGGQVYMDGANLNAQVGLARPADIGADVSHMNLHKTFCIPHGGGGPGMGPI 723 
146284374  644 RLSCLMITYPSTHGVYEENVREICAAIHAQGGQVYMDGANLNAQVGLARPADIGADVSHMNLHKTFCIPHGGGGPGMGPI 723 
152987333  686 RLSCLMITYPSTHGVYEEGIGEICEVVHRHGGQVYMDGANLNAQVGLARPADIGADVSHMNLHKTFCIPHGGGGPGMGPI 765 
167036239  644 RLSCLMITYPSTHGVYEEGIREICEVVHQHGGQVYMDGANLNAQVGLARPADIGADVSHMNLHKTFCIPHGGGGPGMGPI 723 
170724174  644 RLSCLMVTYPSTHGVYEEGIREICEVVHQHGGQVYMDGANLNAQVGLTRPADIGADVSHMNLHKTFCIPHGGGGPGMGPI 723 
218894315  644 RLSCLMITYPSTHGVYEEGIGEICEVVHRHGGQVYMDGANLNAQVGLARPADIGADVSHMNLHKTFCIPHGGGGPGMGPI 723 
226946733  643 TLACLMLTYPSTHGVYEEGVREICEVIHGHGGQVYMDGANLNAQVGLARPADIGADVSHLNLHKTFCIPHGGGGPGMGPI 722 
70733244   721 GVRAHLAPFVANHPVVPIDGPLPENGAVSAAPWGSASILPISWMYIALMGPQLADASEVAILAANYLAEQLSGAFPVLYS 800 
104784212  724 GIRAHLKPFVASHPVVPVPGLDPNMTAVSAAPWGSASILPISWMYIAMMGPQLADASEVAILSANYLASQLRDAFPVLYR 803 
26991868   724 GIRAHLKPFVASHPVVPVPGLDPNNSAVSAAPWGSASILPISWMYIAMMGPQLADASEVAILSANYLASQLGAAFPVLYR 803 
15600406   724 GVKRHLAPFVANHPVIRVEGPNPLNDAVSATPWGSASILPISWMYIAMMGPQLADASEVAILSANYLANRLDGAFPVLYR 803 
77461647   724 GVRAHLAPFVANHPVVPIDGPQPQNGAVSAAPWGSASILPISWMYIAMMGPQLADASEVAILAANYLAQHLSGAFPVLYT 803 
116053361  724 GVKRHLAPFVANHPVIRVEGPNPLNDAVSAAPWGSASILPISWMYIAMMGPQLADASEVAILSANYLANRLDGAFPVLYR 803 
148550299  724 GIRAHLKPFVASHPVVPVPGLDPNNSAVSAAPWGSASILPISWMYIAMMGPQLADASEVAILSANYLASQLGAAFPVLYR 803 
146284374  724 GVKAHLAPFVANHPVVELEGPQPGNGAVSAAPWGSASILPISWMYIAMMGPQLRDATEVAILGANYLANRLGGAFPVLYS 803 
152987333  766 GVKRHLAPFVANHPVIRVEGPDPLNDAVSAAPWGSASILPISWMYIAMMGPQLADASEVAILSANYLANRLDGAFPVLYR 845 
167036239  724 GIRAHLTPFVASHPVVPVPGLDPNNSAVSAAPWGSASILPISWMYIAMMGPQLADASEVAILSANYLASQLGGAFPVLYR 803 
170724174  724 GIRAHLKPFVASHPVVPVPGLDPNNSAVSAAPWGSASILPISWMYIAMMGPQLADASEVAILSANYLASQLGGAFPVLYR 803 
218894315  724 GVKRHLAPFVANHPVIRVEGPNPLNDAVSAAPWGSASILPISWMYIAMMGPQLADASEVAILSANYLANRLDGAFPVLYR 803 
226946733  723 GVKAHLVPFVANHPVVPLDGPNPDNGAVSAAPWGSAGILPISWMYIAMMGPQLKDATEVAILNANYLAHCLGGAFPVLYS 802 
70733244   801 GRNGRVAHECILDLRPLKAQTGISEEDVAKRLMDYGFHAPTMSFPVPGTLMVEPTESESKAELDRFIEAMLSIRAEIAQV 880 
104784212  804 GRNERVAHECILDLRPLKALTGISEEDVAKRLMDYGFHAPTMSFPVPGTLMVEPTESESKAELDRFVEAMLAIRAEIGEV 883 
26991868   804 GRNQRVAHECILDLRPLKALTGISEEDVAKRLMDYGFHAPTMSFPVPGTLMVEPTESESKAELDRFVEAMLAIRAEIDEV 883 
15600406   804 GRNERVAHECILDLRPLKAQTGITEEDVAKRLMDYGFHAPTMSFPVPGTLMVEPTESESKAELDRFVEAMLSIRAEIGKV 883 
77461647   804 GRNERVAHECILDLRPLKAATGISEEDVAKRLMDYGFHAPTMSFPVPGTLMVEPTESESKAELDRFIGAMLSIRAEITEV 883 
116053361  804 GRNERVAHECILDLRPLKAQTGITEEDVAKRLMDYGFHAPTMSFPVPGTLMVEPTESESKAELDRFVEAMLSIRAEIGKV 883 
148550299  804 GRNQRVAHECILDLRPLKALTGISEEDVAKRLMDYGFHAPTMSFPVPGTLMVEPTESESKAELDRFVEAMLAIRAEIEEV 883 
146284374  804 GRNGRVAHECILDLRPLKAASGISEEDVAKRLMDYGFHAPTMSFPVPGTLMIEPTESESKAELDRFVEAMLSIRAEIAKV 883 
152987333  846 GRNERVAHECILDLRPLKAQTGITEEDVAKRLMDYGFHAPTMSFPVPGTLMVEPTESESKAELDRFVEAMLSIRAEIGKV 925 
167036239  804 GRNQRVAHECILDLRPLKALTGISEEDVAKRLMDYGFHAPTMSFPVPGTLMVEPTESESKAELDRFVEAMLAIRAEIAEV 883 
170724174  804 GRNQRVAHECILDLRPLKAITGITEEDVAKRLMDYGFHAPTMSFPVPGTLMVEPTESESKAELDRFVEAMLAIRAEIGEV 883 
218894315  804 GRNERVAHECILDLRPLKAQTGITEEDVAKRLMDYGFHAPTMSFPVPGTLMVEPTESESKAELDRFVEAMLSIRAEIGKV 883 
226946733  803 GRNGRVAHECILDLRPLKAETGITEEDVAKRLMDYGFHAPTMSFPVPGTLMIEPTESESLHELERFVEAMLSIRAEIAKV 882 
70733244   881 QEGNWPAEDNPLKGAPHTLADITGVWERSYSIEQAVLPTAHTRAHKYWPAVNRVDNVYGDRNLFCACVPLADYR 954 
104784212  884 QEGNWPAEDNPLKHAPHTLADVLAPWDRPYSIEQGVAPSAHARQHKYWPAVNRVDNVYGDRNLFCACVPVEAYR 957 
26991868   884 QQGNWPAENNPLKHAPHTLADVLGVWDRPYSLEQAVAPSAHVRQHKYWPAVNRVDNVYGDRNLFCACVPVEAYR 957 
15600406   884 ESGAWPAEDNPLKRAPHTLADVTGIWQRPYEIAEAVTPSEHARAFKYWPAVNRVDNVYGDRNLFCACVPLDDYR 957 
77461647   884 QNGNWPAEDNPLKRAPHTMADITGVWERPYSIEQGITPDAHTKAHKYWPAVNRVDNVYGDRNLFCACVPVDDYR 957 
116053361  884 ESGAWPAEDNPLKRAPHTLADVTGIWQRPYEIAEAVTPSEHARAFKYWPAVNRVDNVYGDRNLFCACVPLDDYR 957 
148550299  884 QQGNWPAENNPLKHAPHTLADVLGGWDRPYSLEQAVAPSAHVRQHKYWPAVNRVDNVYGDRNLFCACVPVEAYR 957 
146284374  884 QDGEWPADNNPLVRAPHTLADVIGEWDRPYSIAEAVTPSAHARAHKYWPAVNRVDNVYGDRNLFCACVPVDAYR 957 
152987333  926 ESGDWPAEDNPLKRAPHTLADVTGVWQRPYEIAEAVTPSAHTRAFKYWPAVNRVDNVYGDRNLFCACAPLEDYR 999 
167036239  884 QEGNWPAENNPLKHAPHTLADVLGVWDRPYSLEQAVAPSAHARQHKYWPAVNRVDNVYGDRNLFCACVPVEAYR 957 
170724174  884 QEGNWPAEDNPLKHAPHTLADVLAPWNRPYSLEQAVAPSAHVRQHKYWPAVNRVDNVYGDRNLFCACVPVEAYR 957 
218894315  884 ESGAWPAEDNPLKRAPHTLADVTGIWQRPYEIAEAVTPSEYARAFKYWPAVNRVDNVYGDRNLFCACVPLDDYR 957 
226946733  883 QAGDWPAEDNPLKHAPHTLADLLGDWQRPYSREEAVAPTAHSRAHKYWPAVNRVDNVYGDRNLFCACVPPDDYR 956 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap