Conserved Protein Domain Family
PRK12562

?
PRK12562: PRK12562 
ornithine carbamoyltransferase subunit F; Provisional
Statistics
?
PSSM-Id: 105755
View PSSM: PRK12562
Aligned: 9 rows
Threshold Bit Score: 702.586
Threshold Setting Gi: 157147747
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
16128258    1 MSDLYKKHFLKLLDFTPAQFTSLLTLAAQLKADKKNGKEVQKLTGKNIALIFEKDSTRTRCSFEVAAFDQGARVTYLGPS 80 
91213809    1 MSGFYHKHFLKLLDFTPAELNSLLQLAAKLKADKKSGKEEARLTGKNIALIFEKDSTRTRCSFEVAAYDQGARVTYLGPS 80 
26251161    1 MSGFYHKHFLKLLDFTPAELNSLLQLAAKLKADKKSGKEEARLTGKNIALIFEKDSTRTRCSFEVAAYDQGARVTYLGPS 80 
146310124   1 MSELYKKHFLKLLDFTPAQVNSLLSLAAQLKADKKNGKEVQKLTGKNIALIFEKDSTRTRCSFEVAAFDQGARVTYLGPS 80 
157147747   1 MSTFYQKHFLKLLDFTSAELTALLQLAAKLKADKKNGVEVARLTGKNIALIFEKDSTRTRCSFEVAAYDQGARVTYLGPS 80 
170079897   1 MSDLYKKHFLKLLDFTPAQFTSLLTLAAQLKADKKNGKEVQKLTGKNIALIFEKDSTRTRCSFEVAAFDQGARVTYLGPS 80 
218692641   1 MSGFYHKHFLKLLDFTPAELNSLLQLAAKLKADKKSGKEEARLTGKNIALIFEKDSTRTRCSFEVAAYDQGARVTYLGPS 80 
218702957   1 MSGFYHKHFLKLLDFTPAELNSLLQLAAKLKADKKSGKEEARLTGKNIALIFEKDSTRTRCSFEVAAYDQGARVTYLGPS 80 
296101045   1 MSDLYKKHFLKLLDFTPAQFTSLLTLAAQLKADKKNGKEVQKLTGKNIALIFEKDSTRTRCSFEVAAFDQGARVTYLGPS 80 
16128258   81 GSQIGHKESIKDTARVLGRMYDGIQYRGHGQEVVETLAQYAGVPVWNGLTNEFHPTQLLADLMTMQEHLPGKAFNEMTLV 160
91213809   81 GSQIGHKESIKDTARVLGRMYDGIQYRGYGQEIVETLAEYAGVPVWNGLTNEFHPTQLLADLLTMQEHLPGKAFNEMTLV 160
26251161   81 GSQIGHKESIKDTARVLGRMYDGIQYRGYGQEIVETLAEYAGVPVWNGLTNEFHPTQLLADLLTMQEHLPGKAFNEMTLV 160
146310124  81 GSQIGHKESIKDTARVLGRMYDGIQYRGHGQDVVETLAQYAGVPVWNGLTNEFHPTQLLADLLTMQEHLPGKSFNEMALV 160
157147747  81 GSQIGHKESIKDTARVLGRMYDGIQYRGHGQEVVETLAEYAGVPVWNGLTNEFHPTQLLADLLTMQEHLPGKAFNEMTLV 160
170079897  81 GSQIGHKESIKDTARVLGRMYDGIQYRGHGQEVVETLAQYAGVPVWNGLTNEFHPTQLLADLMTMQEHLPGKAFNEMTLV 160
218692641  81 GSQIGHKESIKDTARVLGRMYDGIQYRGYGQEIVETLAEYAGVPVWNGLTNEFHPTQLLADLLTMQEHLPGKAFNEMTLV 160
218702957  81 GSQIGHKESIKDTARVLGRMYDGIQYRGYGQEIVETLAEYAGVPVWNGLTNEFHPTQLLADLLTMQEHLPGKAFNEMTLV 160
296101045  81 GSQIGHKESIKDTARVLGRMYDGIQYRGHGQEVVETLAQYAGVPVWNGLTNEFHPTQLLADLLTMQEHLPGKAFNEMTLV 160
16128258  161 YAGDARNNMGNSMLEAAALTGLDLRLLAPKACWPEESLVAECSALAEKHGGKITLTEDVAAGVKGADFIYTDVWVSMGEA 240
91213809  161 YAGDARNNMGNSMLEAAALTGLDLRLVAPQACWPEAALVAECSALAQKHGGKITLTEDIASGVKGADFIYTDVWVSMGEP 240
26251161  161 YAGDARNNMGNSMLEAAALTGLDLRLVAPQACWPEAALVAECSALAQKHGGKITLTEDIASGVKGADFIYTDVWVSMGEP 240
146310124 161 YAGDARNNMGNSMLEAAALLGLDLRLVAPKACWPEESLVAECSALALQNGGKITLTEDVAAGVKGADFIYTDVWVSMGEP 240
157147747 161 YAGDARNNMGNSMLEAAALTGLDLRLVAPQACWPEASLVAECKALAQKNGGDITLTEDIAAGVKGADFIYTDVWVSMGEA 240
170079897 161 YAGDARNNMGNSMLEAAALTGLDLRLLAPKACWPEESLVAECSALAEKHGGKITLTEDVAAGVKGADFIYTDVWVSMGEA 240
218692641 161 YAGDARNNMGNSMLEAAALTGLDLRLVAPQACWPEAALVAECSALAQKHGGKITLTEDIASGVKGADFIYTDVWVSMGEP 240
218702957 161 YAGDARNNMGNSMLEAAALTGLDLRLVAPQACWPEAALVAECSALAQKHGGKITLTEDIASGVKGADFIYTDVWVSMGEP 240
296101045 161 YAGDARNNMGNSMLEAAALTGLDLRLVAPKACWPEESLVAECSALAQKHGGKITLTEDVAAGVKGADFIYTDVWVSMGEA 240
16128258  241 KEKWAERIALLRGYQVNAQMMALTDNPNVKFLHCLPAFHDDQTTLGKQMAKEFDLHGGMEVTDEVFESAASIVFDQAENR 320
91213809  241 KEKWAERIALLRDYQVNSKMMALTGNSQVKFLHCLPAFHDEQTTLGKKMAAEFGLYGGMEVTDEVFESPASIVFDQAENR 320
26251161  241 KEKWAERIALLRDYQVNSKMMALTGNSQVKFLHCLPAFHDEQTTLGKKMAAEFGLYGGMEVTDEVFESPASIVFDQAENR 320
146310124 241 KEKWAERIALLRGYQVNSEMMALTGNPNVKFLHCLPAFHDDHTALGKQMAKEFDLHGGMEVTDEVFESAASIVFDQAENR 320
157147747 241 KEKWAERIALLRQYQVNSAMMAQTGNPQVKFLHCLPAFHDDQTTLGKKMAEEFGLHGGMEVTDAVFESPASIVFDQAENR 320
170079897 241 KEKWAERIALLRGYQVNAQMMALTDNPNVKFLHCLPAFHDDQTTLGKQMAKEFDLHGGMEVTDEVFESAASIVFDQAENR 320
218692641 241 KEKWAERIALLRDYQVNSKMIALTGNSQVKFLHCLPAFHDEQTTLGKKMAAEFGLYGGMEVTDEVFESPASIVFDQAENR 320
218702957 241 KEKWAERIALLRDYQVNSKMMALTGNSQVKFLHCLPAFHDEQTTLGKKMAAEFGLYGGMEVTDEVFESPASIVFDQAENR 320
296101045 241 KEKWAERIALLRGYQVNAQMMALTGNPNVKFLHCLPAFHDDQTTLGKQMAKEFDLHGGMEVTDEVFESAASIVFDQAENR 320
16128258  321 MHTIKAVMMATLGE 334
91213809  321 MHTIKAVMVATLAK 334
26251161  321 MHTIKAVMVATLAK 334
146310124 321 MHTIKAVMVATLGK 334
157147747 321 MHTIKAVMVATLAK 334
170079897 321 MHTIKAVMMATLGE 334
218692641 321 MHTIKAVMVATLAK 334
218702957 321 MHTIKAVMVATLAK 334
296101045 321 MHTIKAVMVATLGG 334
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap