Conserved Protein Domain Family
PRK12551

?
PRK12551: PRK12551 
ATP-dependent Clp protease proteolytic subunit; Reviewed
Statistics
?
PSSM-Id: 139060
View PSSM: PRK12551
Aligned: 20 rows
Threshold Bit Score: 387.648
Threshold Setting Gi: 56750021
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
33861299    1 MIPLVLEESGGSERVFDIYSRLLRERIIFLGEQVTSDTANRIVAQLLFLEAEDPEKDIYMYINSPGGSVYDGLGIFDTMQ 80 
33865835    1 MIPIVIEESGRGERAFDIYSRLLRERIIFLGEAVTSDSANRIVAQMLFLEAEDPEKDIYLYINSPGGSVYDGLGIFDTMQ 80 
33862948    1 MIPIVIEESGRGERAFDIYSRLLRERIIFLGEPVTSDSANRIVAQMLFLEAEDPEKDIYLYINSPGGSVYDGLGIFDTMQ 80 
78184632    1 MIPIVIEESGRGERAFDIYSRLLRERIIFLGEAVTSDSANRIVAQMLFLEAEDPEKDIYLYINSPGGSVYDGLGIFDTMQ 80 
78212970   22 MIPIVIEESGRGERAFDIYSRLLRERIIFLGEAVTSDSANRIVAQMLFLEAEDPEKDIYLYINSPGGSVYDGLGIFDTMQ 101
56750021    1 MIPIVVEESGRGERAFDIYSRLLRERIIFLGEPVTSDVANRIVAQLLFLEAEDPEKDIYLYINSPGGSVYDGLGIFDTMN 80 
81300363    1 MIPIVVEESGRGERAFDIYSRLLRERIIFLGEPVTSDVANRIVAQLLFLEAEDPEKDIYLYINSPGGSVYDGLGIFDTMN 80 
113953920   1 MIPIVIEESGRGERAFDIYSRLLRERIIFLGEPVTSDSANRIVAQLLFLEAEDPEKEIFLYVNSPGGSVYDGLGIFDTMQ 80 
124023248   1 MIPIVIEESGRGERAFDIYSRLLRERIIFLGEPVTSDSANRIVAQMLFLEAEDPEKDIYLYINSPGGSVYDGLGIFDTMQ 80 
148239550   1 MIPIVIEESGRGERAFDIYSRLLRERIIFLGEAVTSESANRIVAQLLFLEAEDPEKDIFLYINSPGGSVYDGLGIFDTMQ 80 
33861299   81 HVKPDIHTVCVGLAASMGAFLLAAGTKGKRSSLRHSRIMIHQPLGGARGQASDIRIQADEILYLKERLNTELSERTGKEL 160
33865835   81 HIKPDVHTVCVGLAASMGAFLLCAGTKGKRSSLQHSRIMIHQPLGGARGQASDIRIQADEILYLKERLNQELSDRTGQPL 160
33862948   81 HVKPDVQTVCVGLAASMGAFLLCAGAMGKRSSLQHSRIMIHQPLGGARGQASDIRIQADEILFLKDRLNRVLADRTGQPL 160
78184632   81 HIKPDVQTVCVGLAASMGAFLLCAGTKGKRSSLQHSRIMIHQPLGGASGQASDIRIQADEILYLKDRLNTELSDRTGQPL 160
78212970  102 HIKPDVHTVCVGLAASMGAFLLCAGTKGKRSSLQHSRIMIHQPLGGAQGQASDIRIQADEILFLKERLNKELSDRTGQTL 181
56750021   81 HIRPDVSTVCVGLAASMGAFLLAAGAKGKRTSLAHSRIMIHQPLGGAQGQAKDIEIQANEILYIKQNLNEVLAERTGQPL 160
81300363   81 HIRPDVSTVCVGLAASMGAFLLAAGAKGKRTSLAHSRIMIHQPLGGAQGQAKDIEIQANEILYIKQNLNEVLAERTGQPL 160
113953920  81 HIKPDVHTVCVGLAASMGAFLLCAGAKGKRSSLQHSRIMIHQPLGGASGQASDIRIQADEILFLKDRLNHELADRTGQPL 160
124023248  81 HVKPDVQTVCVGLAASMGAFLLCAGAMGKRSSLQHSRIMIHQPLGGARGQASDIRIQADEILFLKDRLNRVLADRTGQPL 160
148239550  81 HIKPDVQTVCVGLAASMGAFLLCAGAKGKRSSLRHSRIMIHQPLGGARGQASDIRIQADEILFLKNRLNQELSERTSQPL 160
33861299  161 ETIKGDTDRDFYMSPQEAVEYGLIDLVLDKKPVKNI 196
33865835  161 DRIQQDTDRDFFMSPGEAVEYGLIDSVIDKRPIQAV 196
33862948  161 ERIQEDTDRDFFMSPAEAVGYGLVDSVIDKRPVHSV 196
78184632  161 DRIQEDTDRDFFMSPGEAVSYGLIDSVIDKRPVQAV 196
78212970  182 DRIQQDTDRDFFMSPTEAMNYGLIDSVIDKRPVQAV 217
56750021  161 SRIEDDTDRDFFMSASEAVEYGLIDRVIDRRALKAT 196
81300363  161 SRIEDDTDRDFFMSASEAVEYGLIDRVIDRRALKAT 196
113953920 161 DKIQADTDRDFFMSPQQAMEYGLIDNVIDKSPVRSV 196
124023248 161 ERIQEDTDRDFFMSPTEAVGYGLVDSVIDKRPVHSV 196
148239550 161 EKIQEDTDRDFFMSPNEAVDYGLIDSVIDKRPVHSV 196
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap