Conserved Protein Domain Family
PRK12547

?
PRK12547: PRK12547 
RNA polymerase sigma factor; Provisional
Statistics
?
PSSM-Id: 139056
View PSSM: PRK12547
Aligned: 7 rows
Threshold Bit Score: 311.04
Threshold Setting Gi: 110635436
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
49474607    1 MMEGVKDFKQELLLVLPALRAFAISLSSKHDKAEDLVQDTLMKAWAKQDSFEMGSNLKAWLFTILRNEFYSQMRKRGREV 80 
159186048   5 PEQTEYNFKREMLAALPNLRAFAISLIRSRDRADDLVQDTIMKAWAKQDSFQPGTNMRAWLVTILRNEFYSQIRKSGREV 84 
110635436   1 -MSASPSFRDGLLAAVPTLRAFAVSLAKNADRADDLVQETLVKAWDKQDSFQPGTNLKAWLFTILRNEFYSQMRKRRREV 79 
49476049    1 MAKSMKDFKQELLLILPSLRAFALSLSSKHDKAEDLVQDTLMKAWAKQDSFEMGTNLKAWLFTILRNEFYSQMRKRGREV 80 
13473184    1 MAAVSQGFKTDLLGAIPSLRAFAVSLTQNADKADDLVQETLVKAWDKHESFQPGTNLKAWLFTILRNEFYSQMRKRGREV 80 
163868952   1 MSKCAKNFKQELLVVLPALRAFAVSLSGKHDKAEDLVQDTVMKAWAKQDSFEMGTNLKAWLFTILRNEFYSQMRKKGREV 80 
240851087   1 MSKCAKNFKQELLLVLPALRAFAVSLSGKQDKAEDLVQDTVMKAWAKQDSFEMGTNLKAWLFTILRNEFYSQMRKKGREV 80 
49474607   81 QDSDGVFIESVAIHPAQYGSLDLQDFKKALNMLSADQREAIILIGASGFSYEDAAAICGCAIGTIKSRVSRARNRLQELL 160
159186048  85 QDTDGVYTSRLSVPPEQHGSVDLQDFRTALAKLPDDQREAILLIGASGFAYEEAAEICGCPVGTIKSRVSRARLRLQELL 164
110635436  80 EDSDGSITARLSIHPAQEGNSDLNDFRRALALLPEDQREAIILIGASGFSYEEAAEICGCAVGTIKSRVSRARSRLQEIL 159
49476049   81 QDSEGVFSENVAVHPPQYGSLDLQDFKKALNLLSADQREAIILIGASGFSYEDAAAICGCAVGTIKSRVSRARNRLQELL 160
13473184   81 QDSDGIMTARLAVHPAQHGQLDLKDFRGALEQLPEDQREAIILIGASGFSYEEAAEICGCAVGTIKSRVSRARTRLQEIL 160
163868952  81 QDTDGVFTQNVAVHPPQYGTLDLQDFKKALNLLSADQREAIILIGASGFSYEDAAAICGCAVGTIKSRVSRARHRLQELL 160
240851087  81 QDTDGVFTQNVAVHPAQYGSLDLQDFKKALNLLSADQREAIILIGASGFSYEDAAAICGCAVGTIKSRVSRARNRLQELL 160
49474607  161 KVDR 164
159186048 165 GIEN 168
110635436 160 SISG 163
49476049  161 KVDG 164
13473184  161 KISG 164
163868952 161 NVDG 164
240851087 161 KVDG 164
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap