Conserved Protein Domain Family
PRK12546

?
PRK12546: PRK12546 
RNA polymerase sigma factor; Provisional
Statistics
?
PSSM-Id: 139055
View PSSM: PRK12546
Aligned: 9 rows
Threshold Bit Score: 308.307
Threshold Setting Gi: 146278734
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
77464848    6 KAPAKHRDPRDELPEHLPALRAFAISLTRNVAVADDLVQDTIVKAWTNFDKFTEGTNLRAWLFTILRNTFYSDKRKHRRE 85 
119385544  10 ARSGAHGDPRDELVDHLPALRAFALSLTREGASADDLVQDTIVKAWTHIDKFQPGTNLRAWLFTILRNTFYSARRKTKRE 89 
126463690   6 KAPAKHRDPRDELPEHLPALRAFAISLTRNVAVADDLVQDTIVKAWTNFDKFTEGTNLRAWLFTILRNTFYSDKRKHRRE 85 
146278734   6 TSPPERRDPREELPEHLPALRAFAISLTRNVAVADDLVQDTIVKAWTNFDKFTEGTNLRAWLFTILRNTFYSDKRKHRRE 85 
221640769   6 KAPAKHRDPRDELPEHLPALRAFAISLTRNVAVADDLVQDTIVKAWTNFDKFTEGTNLRAWLFTILRNTFYSDKRKHRRE 85 
110677500   1 ---MNDPDPRFALLDHLPAMRGFATSLTRDSVAADDVVQDAVIKAWTSFDQFQPGTNLRAWLFTILRNTFYSSTRKSGRE 77 
99082563    1 ---MDRQSAKAELTSHMKVLRAFAMSLTRNDAAADDLVQDTVLKAWSNLDKFQEGTNMRAWLFTILRNTFYSGRRKAVRE 77 
89056056    1 ----MAIDPRDEIVEHLPSLRAFARSLTRNPSSADDLVQDTVVKAWSNIDKFQAGTNMRAWLFTILRNTFYSARRKQKRE 76 
159046375   1 MSGAPKADPRDEIVEHLSAMRAFAVSLTRNSATADDLVQDTLVKAWSNIDKFQAGTNMRAWLFTILRNTYYSLRRKRKRE 80 
77464848   86 VPDPEGVHAASLFVKPAHDGHLAFSDFSAAFDQLSPEHREVLILVGASGFAYEDAAQMMGVAVGTVKSRANRARARLAEL 165
119385544  90 VSDTDGVHAARQATRPEHDGRLALNDFRAAFEQLPDEQREALILVGASGFSYEEAAAMTGVAVGTVKSRANRGRRRLAEL 169
126463690  86 VPDPEGVHAASLFVKPAHDGHLAFSDFSAAFDQLSPEHREVLILVGASGFAYEDAAQMMGVAVGTVKSRANRARARLAEL 165
146278734  86 VPDPEGIHAATLYVKPAHDGHLAFSDFSAAFDQLSPEHREVLILVGASGFAYEDAAAMMGVAVGTVKSRANRARARLAEL 165
221640769  86 VPDPEGVHAASLFVKPAHDGHLAFSDFSAAFDQLSPEHREVLILVGASGFAYEDAAQMMGVAVGTVKSRANRARARLAEL 165
110677500  78 VADVDGVHFGALAEKPAHDGRLQMTDFRSAFAQLPDEQREALLLVGASGFSYEEAAEMCGVAVGTIKSRTGRGRQRLAEL 157
99082563   78 VEDSTGSITESLSVKPAHDGRLQLEEFRRALGELPVEQREILTLIGVLQYSYEEAAEVCGVKVGTVKSRLNRGREALAAK 157
89056056   77 VADIDGELTAQLSEKPAHDGRLAMKDFATAFAELPDEQREALLLVGASGFAYEEAADMCGCAVGTIKSRVNRARTRLTEM 156
159046375  81 VEDTEGEMAAGLAQKPDHDGRLQMREFGEAFAELPDEQREALILVGAGGFSYEEAAEMCGVRIGTIKSRVNRARNKLTEL 160
77464848  166 LGLEKGEEIfSGVDGQTLAVMSRSGMTAA 194
119385544 170 LQLEEGEEL-EMTDRATLAVMAQNTPILR 197
126463690 166 LGLEKGEEIfSGVDGQTLAVMSRSGMTAA 194
146278734 166 LGLEKGEEIfSGVDGQTMAVMSRSGMTAA 194
221640769 166 LGLEKGEEIfSGVDGQTLAVMSRSGMTAA 194
110677500 158 MQLEDEEAL-EMTDDATLSVLTAAKATTF 185
99082563  158 MQLDANEQL-ELTDAATHAVVAANNGTAA 185
89056056  157 LDLKEDEAL-ELTDAATVAVVSGKPAA-- 182
159046375 161 LEMSEDDAM-EMTDSVTQGIVAGNQSAA- 187
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap