Conserved Protein Domain Family
PRK12538

?
PRK12538: PRK12538 
RNA polymerase sigma factor; Provisional
Statistics
?
PSSM-Id: 139048
View PSSM: PRK12538
Aligned: 8 rows
Threshold Bit Score: 393.068
Threshold Setting Gi: 161511102
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
146341774   1 MSYALDVRAPADGMSSSEPASPEIMTVPWSESVSTVPDGAPPsEDAVFDEDSELLDRLATGDEVAFRLLVERHIDRAYAI 80 
148254594   1 MNYALDVCAPTDGVPLNAPASPDVAEVPWSESASTVPDCSPG-QVAVFDEDKELLDRLATGDETAFRLLVERHIDRAYAI 79 
161511102   1 MSFAVDVFARAEAEIATTITSE--ANAPVIASASIAPDGEPVaADVVFDEDSELLDRLAADDETAFRMLVERHIDRAYAI 78 
39933716    1 MNGALDVLAPAEVIVAATAPAD--NEASDMPPVEIVLDSPPVsAEMVFDEDADLLDRLATDDEAAFRMLVERHIDRAYSI 78 
115522808   1 MTYALDIWAPVEAAPAVMTTPPLAAAMPNEAPCDGAAGPRPP------DDDDRLLARLAGNDEAAFRLLVERHIDRAFSV 74 
90422384    1 MAFALDIWAPVEVAPAVIAKSTSVSSAPAAACEQQLPTPP-------LDEDEQLLNRLAEHDEAAFRLLVERHIDRAFGI 73 
86747885    6 HTEPVDTLATPPAASATLAPDAIVPHDPDAPR----------------DIDEELLDRLAANDEAAFRLLVERHIDRAFGI 69 
192289136   1 MNGALDVLAPAEVIVAATAPAD--NEASDMPPVEIVLDSPPVsAEMVFDEDADLLDRLATDDEAAFRMLVERHIDRAYSI 78 
146341774  81 ALRIVGSAADAEDVVQDTMLKVWTHRGRWQHGRAKFSTWLYRVVSNRCIDLRRKPRTENVDVVPEVPDGKPDAVSVIERA 160
148254594  80 ALRIVGNAADAEDVVQDTMLKVWTHRGRWQHGRAKFSTWLYRVVSNRCIDLRRKPRTENVDVVPEVADGKPDAASVIERA 159
161511102  79 ALRIVGNAADAEDVVQDSMLKIWSHRGRWQHGRAKFSTWLYRVISNRCIDLRRKPRTENVDTVPEVADGRPDASRVIERN 158
39933716   79 ALRILGNSADAEDVVQDTMLKVWTHRGRWQHGRAKFSTWLYRVVSNRCIDLRRKPRTENVEAVPEVADTQPDAVRVIERN 158
115522808  75 ALRVVGNRADAEDVVQDTMLKVWTHRGQWQQGRAKFSTWLYRVVTNRCIDLRRQPRTDNVDAVPEPADDQPDVVTTIQRD 154
90422384   74 ALRIVGNRADAEDVVQDTMLKVWTHRGQWQHGRAKFSTWLYRVVTNRCIDLHRQPRTDCVDAVPEPADGRPDVVSTMQRD 153
86747885   70 ALRLLGSRADAEDVVQDTMLKVWTHRGRWEHGRAKFSTWLYRVVTNRCIDLHRRPRTDNVDAVPEPADAKPDACSTMQRN 149
192289136  79 ALRILGNSADAEDVVQDTMLKVWTHRGRWQHGRAKFSTWLYRVVSNRCIDLRRKPRTENVEAVPEVADTQPDAVRVIERN 158
146341774 161 QMSDLLESAMQRLPEQQRVAVILSYHENMSNGEIAEVMETTVTAVESLLKRGRQQLREMLRRHERDIRGAFTDC 234
148254594 160 EMSDLLEAAMRRLPEQQRVAVILSYHENMSNGEIAEVMDTTVSAVESLLKRGRQQLRDMLRRHERDICGAFTDC 233
161511102 159 ELNGMLEEAMQRLPEQQRIAVILSYHEDMSNGEIAEVMDSTVAAVESLLKRGRQQLRQLLRRHERDIRTAFTDC 232
39933716  159 ELSNLLEAAMQRLPEQQRIAVILSYHENMSNAEIAEVMDTTIAAVESLLKRGRQQLRARLSGDESELRAAFTDF 232
115522808 155 EVSLLLEAAMQRLPEQQRIAMILSYHQDMSNGEIAEVMETTVAAVESLLKRGRQQLRDLLRRNERDIRHIFTD- 227
90422384  154 EVTHLLENAMRQLPEQQRIAVIFSYHENMSNGEIAEVMETTVAAVESLLKRGRQQLRDLLRRHERDIRHVFTEY 227
86747885  150 EITQLLETAIQKLPEQQRVAVILSYHENMSNGDIAEVMSTTVAAVESLLKRGRQQLREILRRHEPDLLQAFTDC 223
192289136 159 ELSNLLEAAMQRLPEQQRIAVILSYHENMSNAEIAEVMDTTIAAVESLLKRGRQQLRARLSGDESELRAAFTDF 232
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap