Conserved Protein Domain Family
PRK12537

?
PRK12537: PRK12537 
RNA polymerase sigma factor; Provisional
Statistics
?
PSSM-Id: 171568
View PSSM: PRK12537
Aligned: 9 rows
Threshold Bit Score: 324.038
Threshold Setting Gi: 28872288
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66043631    1 MSSHESLFDYEATLQACARGEKQALQRLYQQESARLLGVAQRLVRDRALAEDIVHDAFLKIWSHAASFDASRGSARGWIF 80 
28872288    1 MSSHESLFDYEATLQACARGEKQALQRLYLQESARLLGVAQRLVRDSALAEDIVHDAFLKIWTHAASFDASRGSARGWIF 80 
26989725    1 MNSPAAPFDFHRCLLACAQGDRRALQALYDHEGARLLGVARRIARDDATAEDIVHDAIIRIWTRAASYDPARGSARGWIY 80 
134094095   1 MPADSAFFDYDAALHACALGDEHALQRIYIHDSKRLLGVALRIVRQRHLAEDVVHDAFVSIWNKAASFDAKRGEGRGWIY 80 
148547902  21 LNSPATPFDFHRCLLACAQGDRRALQALYDHESARLLGVARRIARDDATAEDIVHDAIIRIWTRAASYDPARGSARGWIY 100
152981847  33 LSLNEETFDYDAALRACARGERAALQQIYQQDGKRLLGVALRIVRQRALAEDVLHDAFVNIWRKAGSFDAARGSGRGWIH 112
170722228   1 MNSPLPPFDFQRCLEACARGDRRALHALYEEEGARLLGVVRRIARDHATAEDILHDAFIRIWSGAASFDPARGSARGWIY 80 
229590189   1 ------MFDYEACLLACARGDQRALRALYQQESSHLLGVALRIVRDKSLAEDIVHDAFIKIWRGAGSFDPSRGSARGWVF 74 
255961268   8 MPLPETAFDYEARLAACARGERGALRELYVQESPRLLGVARRLVRDTALAEDIVHDAFIKIWAGASGFDPARGSARGWMF 87 
66043631   81 SVTRHLALNTLRNTTREVRVEDDGSEdhheqaTLEGWQEIGDAFDWQVNPGRITSCLEQLEPVRRNCIFHAYVDGYSHQE 160
28872288   81 SVTRHLALNTLRNTAREVRVEDDGSDdhheqaTLEGWQETGDAFDWRVNPGRMISCMEQLEPVRRNCIFHAYVDGYSHQE 160
26989725   81 SITRHLALNSIRDTRRETVLTDADTE------TASTLHGRVDDLDLWSGSAKIYRCLEQLQPAPQRCILHAYVDGCSHAE 154
134094095  81 SVVRHHALNMLRDRDREVYADEDAIDn----mQHQNQELIIDQFELNDSLGQLQDCLSHLDSAKRNSILCAYVDGCSHSE 156
148547902 101 SITRHLALNSIRDTRRETVLTDADTE------TASTLHGRIDDLELWSGSAKIYRCLEQLQPAPQRCILHAYVDGCSHAE 174
152981847 113 SVVRHQALNLVRDRQQEVYTDEDTVEa----lDAQQGIEAQDPFETHVNLGKLDDCLSHLDHAKRNSLLYAYVDGCSHRE 188
170722228  81 SVTRHLALNYIRDSRREVVLDEGAFD------SAQVPLPYASDMDLMADSAKVHRCLEQLEPSRKLCILHAYVDGCSHAE 154
229590189  75 SVTRHLALNVVRNHYREVPLGDEHEP-----------VAATDTFEFSARTGQVHTCLEQLDPTRRTCILHAYVDGYSHSE 143
255961268  88 SVTRHLALNVLRNHDRETPLNDSNES-----------PAIDDDFDALAQSTRIHRCLHQLEPQRRRCILHAYVDGYSHAQ 156
66043631  161 IAQKIGAPLGTVKAWIKRSLTALRECMG 188
28872288  161 IAQKIGAPLGTVKAWIKRSLTALRECMG 188
26989725  155 IAGLLGAPLGTVKAWIKRSLKALRECLE 182
134094095 157 IAQRLNAPLGSVKAWVKRGLAALRECMG 184
148547902 175 IAGLLGAPLGTVKAWIKRSLKALRECLE 202
152981847 189 IAERMKSPVGSVKAWIKRGLLALRECMG 216
170722228 155 IAGLLNTPLGTVKAWIKRSLKALRECMG 182
229590189 144 IAQKLDTPLGTVKAWIKRSLAALRECMT 171
255961268 157 IAQRLDTPLGTVKAWIKRSLNALRECMG 184
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap