Conserved Protein Domain Family
PRK12532

?
PRK12532: PRK12532 
RNA polymerase sigma factor; Provisional
Statistics
?
PSSM-Id: 171564
View PSSM: PRK12532
Aligned: 9 rows
Threshold Bit Score: 341.139
Threshold Setting Gi: 119899147
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15677957    1 MPLPDLTDAELIESRKLLLHFARLQLPDHPDLAEDLVQETLLSAYSAGDSFQGRALVNSWLFAILKNKIIDALRQIGRQR 80 
59802256    1 MPLPDLTDAELMESRKLLLHFARLQLPDHPDLAEDLVQETLLSAYSAGDSFQGRALVNSWLFAILKNKIIDALRQIGRQR 80 
121635789   1 MPLPDLTDAELIESRKLLLHFARLQLPDHPDLAEDLVQETLLSAYSAGDSFQGRALVNSWLFAILKNKIIDALRQIGRQR 80 
161871007   1 MPLPDLTDAELIESRKLLLHFARLQLPDHPDLAEDLVQETLLSAYSAGDSFQGRALVNSWLFAILKNKIIDALRQIGRQR 80 
119899147   3 QPVPDLL---LGEFRPQMLKFARLQLQDGAA-AEDVVHDAISAALEGVNRFSGRAALKTWIFAILRHKIVDALRERGRTV 78 
194099797   1 MPLPDLTDAELMESRKLLLHFARLQLPDHPDLAEDLVQETLLSAYSAGDSFQGRALVNSWLFAILKNKIIDALRQIGRQR 80 
218767257   1 MPLPDLTDAELIESRKLLLHFARLQLPDHPDLAEDLVQETLLSAYSAGDSFQGRALVNSWLFAILKNKIIDALRQIGRQR 80 
237653400   8 AAAPPWDDASISAIRRDMLRFARMQLRDSGA-AEDMVQEALMAAMRSAKSFAGRSAFKTWMFAILRNKIVDHIRASSREI 86 
254804059   1 MPLPDLTDAELIESRKLLLHFARLQLPDHPDLAEDLVQETLLSAYSAGDSFQGRALVNSWLFAILKNKIIDALRQIGRQR 80 
15677957   81 KVFTTLDDEL-LD---EAFESHFSQNGHWTQEGQPQHWNTPEKSLNNNEFQKILQSCLYNLPENTARVFTLKEILGFSSD 156
59802256   81 KVFTALDDEL-LD---EAFESHFSQNGHWTPEGQPQHWNTPEKSLNNNEFQKILQSCLYNLPENTARVFTLKEILGFSSN 156
121635789  81 KVFTTLDDEL-LD---EAFESHFSQNGHWTPEGQPQHWNTPEKSLNNNEFQKILQSCLYNLPENTARVFTLKEILGFSSD 156
161871007  81 KVFTALDDEL-LD---EAFESHFSQNGHWTPEGQPQHWNTPEKSLNNNEFQKILQSCLYNLPENTARVFTLKEILGFSSD 156
119899147  79 QISSLEKDEAdMD---EAFDALFAANAHWHPASRPRDWGDPEETLAQRQFWQVFETCLELLPANTARVFMMREFLGFETP 155
194099797  81 KVFTALDDEL-LD---EAFESHFSQNGHWTPEGQPQHWNTPEKSLNNNEFQKILQSCLYNLPENTARVFTLKEILGFSSN 156
218767257  81 KVFTALDDEL-LD---EAFESHFSQNGHWTPEGQPQHWNTPEKSLNNNEFQKILQSCLYNLPENTARVFTLKEILGFSSD 156
237653400  87 CSSDLVGSSD-LDaglEEFDVLFKQGGHWNPDDRPATWSDPEAAFEQDAFWQVFDLCMNKLPEHIARVYTMRELLELETA 165
254804059  81 KVFTALDDEL-LD---EAFESHFSQNGHWTPEGQPQHWNTPEKSLNNNEFQKILQSCLYNLPENTARVFTLKEILGFSSD 156
15677957  157 EIQQMCGISTSNYHTIMHRARESLRQCLQIKWFNQENPK 195
59802256  157 EIQQMCGISTSNYHTIMHRARESLRQCLQIKWFNQENPK 195
121635789 157 EIQQMCGISTSNYHTIMHRARESLRQCLQIKWFNQENPK 195
161871007 157 EIQQMCGISTSNYHTIMHRARESLRQCLQIKWFNQENPK 195
119899147 156 EICRNLDISTSNCHVILHRARAGLRQCLERGWFNPEVRS 194
194099797 157 EIQQMCGISTSNYHTIMHRARESLRQCLQIKWFNQENPK 195
218767257 157 EIQQMCGISTSNYHTIMHRARESLRQCLQIKWFNQENPK 195
237653400 166 EICAELGITPNNCFVILHRARLGLRECLENRWFQGESR- 203
254804059 157 EIQQMCGISTSNYHTIMHRARESLRQCLQIKWFNQENPK 195
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap