Conserved Protein Domain Family
PRK12531

?
PRK12531: PRK12531 
RNA polymerase sigma factor; Provisional
Statistics
?
PSSM-Id: 105726
View PSSM: PRK12531
Aligned: 9 rows
Threshold Bit Score: 375.423
Threshold Setting Gi: 15642300
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15642300    1 MFNPSPHTFGRQEWLECMEKVKSRDTQAFALVFSYYSPKLKQFVMKHVGSEQVALELVQETMSTVWQKASLFDGQKSSLA 80 
161501819   4 PVANSPSSMSKQDWAECMAKVKDKDKQAFAVVFQHFAPKLKQFAFKHVGNEQVAMEMVQETMTTVWHKAHLFDAEKSALS 83 
28899132    1 MMSDSPQKLGRNEWNAYMDKVKAKDREAFAFVFRFYAPKLKQFAYKHVGNEQVAMEMVQETMATVWQKAHLYDGKKSALS 80 
37680783    4 PVANSPSSMSKQDWAECMAKVKDKDKQAFAVVFQYFAPKLKQFAFKHVGNEQVAMEMVQETMTTVWHKAHLFDAEKSALS 83 
147673682   1 MFNPSPHTFGRQEWLECMEKVKSRDTQAFALVFSYYSPKLKQFVMKHVGSEQVALELVQETMSTVWQKASLFDGQKSSLA 80 
156975552   1 MMSESPQKLGRSEWNDYMDKVKARDKDAFAFVFRFYAPKLKQFAYKHVGNEQVAMEMVQETMATVWQKAHLYDGTKSALS 80 
229607130   1 MFNPSPHTFGRQEWLECMEKVKSRDTQAFALVFSYYSPKLKQFVMKHVGSEQVALELVQETMSTVWQKASLFDGQKSSLA 80 
227082426   1 MFNPSPHTFGRQEWLECMEKVKSRDTQAFALVFSYYSPKLKQFVMKHVGSEQVALELVQETMSTVWQKASLFDGQKSSLA 80 
262393473  14 MMSDSPKKLGRSDWNDYMDKVKARDKDAFAFVFRFYAPKLKQFAYKHVGNEQVAMEMVQETMATVWQKAHLYDGEKSALS 93 
15642300   81 TWIYTIARNLSYDLLRRQKGRDAYVLADDIWPEDYCPPDLVDHYAPEQDLLKEQVMKFLDRLPEAQQQVIKAVYLEEIPQ 160
161501819  84 TWVYTIIRNLCFDLLRKQRGKDLHIHADDIWPSDYYPLDLVERYSPEQDMLKEQVMRFLDCLPKAQRDVLQAVYIEDLPH 163
28899132   81 TWIYTIIRNLCFDLLRKQKGKELHIHSDDIWPSEYYPPDMVDHYSPEQDMLKEQVVKFLDILPKNQRDVLQAVYLEELPH 160
37680783   84 TWVYTIIRNLCFDLLRKQRGKDLHIHADDIWPSDYYPLDLVERYSPEQDMLKEQVLRFLDCLPKAQRDVLQAVYIEDLPH 163
147673682  81 TWIYTIARNLSYDLLRRQKGRDAYVLADDIWPEDYCPPDLVDHYAPEQDLLKEQVMKFLDRLPEAQQQVIKAVYLEEIPQ 160
156975552  81 TWIYTIIRNLCFDLLRKQKGKDLHIHSDDIWPSDYYPPDLVDHYSPEQDMLKEQVVKFLDILPKNQREVLQAVYLQELPH 160
229607130  81 TWIYTIARNLSYDLLRRQKGRDAYVLADDIWPEDYCPPDLVDHYAPEQDLLKEQVMKFLDRLPEAQQQVIKAVYLEEIPQ 160
227082426  81 TWIYTIARNLSYDLLRRQKGRDAYVLADDIWPEDYCPPDLVDHYAPEQDLLKEQVMKFLDRLPEAQQQVIKAVYLEEIPQ 160
262393473  94 TWIYTIIRNLCFDLLRKQKGKELHIHSDDIWPSEYYPPDLVDHYSPEQDMLKEQVVKFLDILPKNQRDVLQAVYLEELPH 173
15642300  161 QDVADMLDIPLGTVKSRLRLAVEKLRLSMDAESL 194
161501819 164 QQVAEMFDIPLGTVKSRLRLAVEKLRHTMQADKL 197
28899132  161 QQVAELFDIPLGTVKSRLRLAVEKLRHSMHTEQL 194
37680783  164 QQVAEMFNIPLGTVKSRLRLAVEKLRHTMQADKL 197
147673682 161 QDVADMLDIPLGTVKSRLRLAVEKLRLSMDAESL 194
156975552 161 QQVAELFDIPLGTVKSRLRLAVEKLRHSMHTEQL 194
229607130 161 QDVADMLDIPLGTVKSRLRLAVEKLRLSMDAESL 194
227082426 161 QDVADMLDIPLGTVKSRLRLAVEKLRLSMDAESL 194
262393473 174 QQVAELFDIPLGTVKSRLRLAVEKLRHSMHTEQL 207
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap