Conserved Protein Domain Family
PRK12528

?
PRK12528: PRK12528 
RNA polymerase sigma factor; Provisional
Statistics
?
PSSM-Id: 171561
View PSSM: PRK12528
Aligned: 13 rows
Threshold Bit Score: 280.577
Threshold Setting Gi: 152984061
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
167035585   1 MPSalsSTVEGLYHAHHNWLTSWLRRRLGCPQSAADLAQDTYLRLLQARETPQLIEPRAFLATVAKRVLCNHFRRQELER 80 
116051936   7 AHA---AALHTLYSDHHHWLTGWLRRRLGCPQNAADLAQDTFVKVLVSRQAARIDEPRAFLTTIARRVLCNHYRRQDVER 83 
15599094    7 AHA---AALHTLYSDHHHWLTGWLRRRLGCPQNAADLAQDTFVKVLVSRQAARIDEPRAFLTTIARRVLCNHYRRQDVER 83 
152984061   7 AHA---AALHTLYSDHHHWLTGWLRRRLGCPQNAADLAQDTFVKVLVSRQATRIDEPRAFLTTIARRVLCNHYRRQDVER 83 
218889820   7 AHA---AALHTLYSDHHHWLTGWLRRRLGCPQNAADLAQDTFVKVLVSCQAARIDEPRAFLTTIARRVLCNHYRRQDVER 83 
77457152    4 SSA---HPVESLYQAHHSWLTGWLRRRLGCPDSAADLAQDTFIRLLTAREPAVIIEPRAFLTTLAKRVLFNHYRRQDLER 80 
229588583   5 SPS---NTVEVLYNDHHRWLTGWLRRKLGCPESAADLAQDTFIRVLTARETPPLIEPRAFLTTVAKRVLFNFYRRQDLER 81 
70728366    2 SHT---ATVEGLYQAHHSWLNTWLRRRLGCPHSAADLAQDTFIRVLSARETPALIEPRAFLTTIAKRVLFNHYRRQDLER 78 
26991295    7 VTSaltSTVEGLYHAHHNWLTGWLRRRLGCPHSAADLAQDTYMRLLQAREAPQLVEPRAFLATVAKRVLCNHFRRQELER 86 
161611338   4 AHSalnHTVESLYRAHNTWLTTWLRRRLGCPHSAADLAQDTFIKVLGARDTQQIVEPRAFLTTIAKRVLCNHYRRQDLEH 83 
66044293    4 AHSalnHTVEGLYRAHNAWLTTWLRRRLGCPHSAADLAQDTFIKVLGARDTAQIVEPRAFLTTIAKRVLCNHYRRQDLEH 83 
28868422    5 AHSapnHTVEGLYRAHNVWLTTWLRRRLGCPHSAADLAQDTFVKVLGARDTAQIIEPRAFLTTIAKRVLCNHYRRQDLER 84 
104783537   1 MPSalsSTVEGLYVAHHSWLTGWLRRRLGCPQSAADLAQDTYVRLLQARETPQLIEPRAFLTTVAKRVLCNHFRRQELER 80 
167035585  81 AYLQALAQIPEEVAPSEEQKAIIFETLLELDRLLDGLPPLVKRAFLLAQVDGLGQGEIARELGISLATVKRYLSKAAMRC 160
116051936  84 AYLEALASLPEREVPSEETRAIVLETLVELDRLLDGLPPLAKETFLLAQLDGLGYAEIATQLGISLSSVKRYMLKAAQRC 163
15599094   84 AYLEALASLPEREVPSEETRAIVLETLVELDRLLDGLPPLAKETFLLAQLDGLGYAEIATQLGISLSSVKRYMLKAAQRC 163
152984061  84 AYLEALASLPECELPSEETRAIVLETLVELDHLLDGLPPLAKETFLLARLDGLGYAEIATQLGISLSSVKRYMLKAAQRC 163
218889820  84 AYLEALASLPEREVPSEETRAIVLETLVELDRLLDGLPPLAKETFLLAQLDGLGYAEIATQLGISLSSVKRYMLKAAQRC 163
77457152   81 AYLDTLAQMPEMVAPSEEEKAIILQTLMELDQLLDGLPRAVKRAFLMAQVDGLTYPQIATELGISVATVKRHLNKAAMRC 160
229588583  82 AYLDALAHMPEHVAPSEEERAIILQTLVELDQLLDGLPVQVKRAFLLAQLDGLTYAQIGAELGISIATVKRHLNKAAMRC 161
70728366   79 AYQETLAQMPEQVAPSEEERAIILQTLMELDSLLDGLPRPVKRAFLLCQLDGLTYGEIARELNISIATVKRHLNKAAMRC 158
26991295   87 AYLQALAQVPEEVAPCEEQKAIIFETLLALDHLLDGLPPLVKRAFLLAQVDGLGQGEIARELGISLATVKRYLNKAAMRC 166
161611338  84 AYYQALAELPECVAPSEEERAIILETLVELDQLLDGLPVLVKRAFLMSQVDGLSHGQIAAELGISIATVKRHLNKAALRC 163
66044293   84 AYYQALAELPERVAPSEEERAIILETLVELDQLLDGLPALVKRAFLLSQVDGLSHGRIAAELGISIATVKRHLHKAALRC 163
28868422   85 AYYQALAELPECAAPSEEERAIILETLVELDQLLDGLPALVKRAFLMSQVDGLSHGQIAAELDISIATVKRHLNKAALRC 164
104783537  81 AYLEALAQVPEQVAPSEEDKAIIFATLLELDRLLDGLAPLVKRAFLLAQVDGLGQGEIARELGISLATVKRYLNKAALRC 160
167035585 161 YFAL 164
116051936 164 YFAE 167
15599094  164 YFAE 167
152984061 164 YFFD 167
218889820 164 YFAE 167
77457152  161 YFAL 164
229588583 162 YFAL 165
70728366  159 YFAL 162
26991295  167 YFAL 170
161611338 164 YFAL 167
66044293  164 YFAL 167
28868422  165 YFAL 168
104783537 161 YFAL 164
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap