Conserved Protein Domain Family
PRK12527

?
PRK12527: PRK12527 
RNA polymerase sigma factor; Reviewed
Statistics
?
PSSM-Id: 171560
View PSSM: PRK12527
Aligned: 14 rows
Threshold Bit Score: 242.373
Threshold Setting Gi: 33603094
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
116050328   1 MENHYRELLRFLSARLGDRHAAADVAHDAYLRVLERSSQAQIEHPKAFLYRTALNLAVDEHRRSRVRRAEPLEVLDDEEG 80 
15597583    1 MENHYRELLRFLSARLGDRHAAADVAHDAYLRVLERSSQAQIEHPKAFLYRTALNLAVDEHRRSRVRRAEPLEVLDDEEG 80 
152985387   1 MENHYRELLRFLCARLGDRQAAADVAHDAYLRVLERSSQARIEHPRAFLYRTALNLAVDEHRRSRVRKAEPLHVLDEEEG 80 
218891637   1 MENHYRELLRFLSARLGDRHAAADVAHDAYLRVLERSSQAQIEHPKAFLYRTALNLAVDEHRRSRVRRAEPLEVLDDEEG 80 
77458085    2 LENYYRELVCFLNARLGNRQVAEDVVHDAYLRVLERSSETPIEQPRAFLYRTALNLVIDDHRRNALRQVESLEVLDSEER 81 
229591408   2 LENYYRELVCFLNAKLGNRQVAEDVVHDAYVRVLERSSDTPIEQPRAFLYRTALNLVIDGHRRNALRQVEPLDVLDNEER 81 
161501968   1 MENYYRELMCFLNAKLGNRQVAEDVVHDAYVRVLERSSDTPIEQPRAFLYRTALNLVIDGHRRNALRQSEPLEVLDNEER 80 
167034775   1 MEHYYRELVGFLSARLGSRQAAEDVAHDAYLRVLERTDAERIEHPRAFLYRTALNLVVDRHRRHLVRQAEPLEVLDSDER 80 
170722696   1 MEHYYRELVSFLSARLGSRQAAEDVAHDAYLRVLERTGTQQIEHPRAFLYRTALNLVIDRHRRHLLRQSEPLEVLDLDER 80 
104782680   1 MEHYYRELVSFLSARLGNRQAAEDVAHDAYLRVLERTEGEQIEHPRAFLYRTALNLVVDRHRRHQIRQVEPLEVLDSDER 80 
116050328  81 LASPSPQTVVDQGQRLDNLQRALAELPAICRSSFLLRKLDGLSHSQIAEHLNISRSLVEKHIVNAMKHCRVRMREWEAD 159
15597583   81 LASPSPQTVVDQGQRLDNLQRALAELPAICRSSFLLRKLDGLSHSQIAEHLNISRSLVEKHIVNAMKHCRVRMREWEAD 159
152985387  81 MSEPSPQVLEDQRQRLDLLSLALNELPPLCRESFLLRKLEGLSHNEIAAHLNISRSLVEKHIVNAMKHCRLRMRAWESS 159
218891637  81 LASPSPQTVVDQGQRLDNLQRALAELPAICRSSFLLRKLDGLSHSQIAEHLNISRSLVEKHIVNAMKHCRVRMREWEAD 159
77458085   82 YFTPSPHNTFDHGQRLEMLQRALAELSPLCRESFLLRKIEGLSHPEIAQHLGISKALVEKHIVNAMKHCRLRIKQWDAH 160
229591408  82 FAACSPHTTHDHSQRLELLERALAELPPACRDSFLLRKLEGLTHVQIAERLCISRALVEKHIVNAMKHCRVRMREWEAH 160
161501968  81 YFNPSPQTSLDHGQRLEMLQRALAELPRLCRESFLLRKLEGLSHPQIAEQLGISRSLVEKHIVNAMKHCRSRLRQWDAQ 159
167034775  81 WHSPAPAHDMQLDQRLALMQRALDELSKICRDCFLLRKLEGLSHQQIAEHLGISRSLVEKHIVNAMKHCRLRMREWES- 158
170722696  81 WHSPAPTQNMQLDQRLALMQKALDELSQPCRDSFLLRKLEGLSHQQIAEHLGISRSLVEKHIVNAMKHCRVRMRQWES- 158
104782680  81 WHSPAPVQSMQLDQRLALMQRALGELSAQCRDSFLLRKIDGLSHQQIAERLGISRSLVEKHIVNAMKHCRVRMRLWES- 158
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap