Conserved Protein Domain Family
PRK12525

?
PRK12525: PRK12525 
RNA polymerase sigma factor; Provisional
Statistics
?
PSSM-Id: 139037
View PSSM: PRK12525
Aligned: 7 rows
Threshold Bit Score: 312.265
Threshold Setting Gi: 15597246
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
116050040   2 DSQGSIKNTLIAQLFQQNYDWLCKKLSYQTGCSHSAEDLAAEAFLQVWMLPDPASIRSPRAFLATIAQRLMYESWRRKDL 81 
116050001   1 MGMDQTRNRLVGLMFQNDYSWLSGRLRRYLGCPHSAEDIASETFLKVLALPDPASIREPRALLTTIARRLMYDGWRRQDL 80 
15597289    2 DSQGSIKNTLIAQLFQQNYDWLCKKLSYQTGCSHSAEDLAAEAFLQVWMLPDPASIRSPRAFLATIAQRLMYESWRRKDL 81 
15597246    1 MGMDQTRNRLVGLMFQNDYSWLSGRLRRYLGCPHSAEDIASETFLKVLALPDPASIREPRALLTTIARRLMYDGWRRQDL 80 
218891993   1 MGMDQTRNRLVGLMFQNDYSWLSGRLRRYLGCPHSAEDIASETFLKVLALPDPASIREPRALLTTIARRLMYDGWRRQDL 80 
218891950   2 DSQGSIKNTLIAQLFQQNYDWLCKKLSYQTGCSHSAEDLAAEAFLQVWMLPDPASIRSPRAFLATIAQRLMYESWRRKDL 81 
77459348    1 MGSHNPHYQVIGQMFQKDYRWLCAAVSRTLGCPHSAQDIASETFLRVLALPDPLAIREPRALLTTIARRLVYEGWRRQDL 80 
116050040  82 ERAYLQILAEAPEAVQPSPHEQWMLIESLQAIDRLLDGLSGQARAVFLMSQLEGLTYVQIGERLGLSLGRIHQLMKDALH 161
116050001  81 ERAYLDSLAGLPEALAPSAEEQAQVVETLLRLERMLAGLSPKARAAFIHSQIGGLTYVEIAGLLEVSVSRIHQYMVEGFK 160
15597289   82 ERAYLQILAEAPEAVQPSPHEQWMLIESLQAIDRLLDGLSGQARAVFLMSQLEGLTYVQIGERLGLSLGRIHQLMKDALH 161
15597246   81 ERAYLESLAGLPEALAPSAEEQAQVVETLLRLERMLAGLSPKARAAFIHSQIGGLTYVEIACLLEVSVSRIHQYMVEGFK 160
218891993  81 ERAYLESLAGLPEALAPSAEEQAQVVETLLRLERMLAGLSPKARAAFIHSQIGGLTYVEIAGLLEVSVSRIHQYMVEGFK 160
218891950  82 ERAYLQILAEAPEAVQPSPHEQWMLIESLQAIDRLLDGLSGQARAVFLMSQLEGLTYVQIGERLGLSLGRIHQLMKDALH 161
77459348   81 ERAYLQSLALAPEPVHPSPEERELVIETLLAVDRLLNGLSAKAKAAFLYHQLDGLTYSEIGERLGVSTSRVQQYMVEAFK 160
116050040 162 CCYRGFQE 169
116050001 161 QCYQVLAE 168
15597289  162 CCYRGFQE 169
15597246  161 QCYQVLAE 168
218891993 161 QCYQVLAE 168
218891950 162 CCYRGFQE 169
77459348  161 RCYQAMQA 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap