Conserved Protein Domain Family
PRK12514

?
PRK12514: PRK12514 
RNA polymerase sigma factor; Provisional
Statistics
?
PSSM-Id: 105710
View PSSM: PRK12514
Aligned: 5 rows
Threshold Bit Score: 302.51
Threshold Setting Gi: 89053139
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
159185000   1 MQGTEIATLINRVGMGDRSAFVSLYQATSPKLFAICLKILRDRTEAEEALQEIYIKVWQRARTFAVSAGKPATWLATIAR 80 
89053139    2 TGPDHIEGLILQVSLGNRDAFSDLYDATSGKLFSICLKVLKNRSEAEDALQDAYMRIWNKADHYAVTGHSPMTWLITLTR 81 
13474039    1 MTPQDITKLIVRTSMKDRAAFDLLYRQTSAKLFGVCLRVLNDRGDAEEALQEVFVKIWTKADRFAVSDLSPISWLVAIAR 80 
99077920    6 TDTNDIENAIMRVGLGDRAAFSFLYDATSAKLFGVCLRVLGDRAEAEDTLQDVFVKVWHKADRYKANGYSPMTWLITLTR 85 
153009024   2 KQTDETSVLISKVALGDKDAFASLYKDTSPKLFAICLRILKDRSEAEEALQDVYIKIWKRSSTFGIGESVASAWLATIAR 81 
159185000  81 NHAIDTIRARKPASDDIDEAYDLVDESiRDPEQQVVLVDEGRRIDDCMRELETVHAQAVRRAYVEGLSYLELSDELRVPL 160
89053139   82 NLAIDRLRKRRAVEVDLDEVGDITESR-PGPEAAAIAASEAGRIRACLEELPGDRAAAVRAAYLEGAAYKDLARHHDVPL 160
13474039   81 NHAIDRVRARRKSAADIDAALEVADPA-PGPEAMVVAGDESQRIHHCLEELEKDRAAAVRGAYLKGESYAELAERHGVPL 159
99077920   86 NTAIDRLRARKAGNVDIDDAHDLSDGS-PTPEAEAIASSERQRLNACFEELQADRSEAVRRAYLDGDSYKDLAARYDVPL 164
153009024  82 NHSIDVIRARKPVTEDLDEIHDLADDVnPSPEKEVLARDEGRRIDDCMRELDQVHAKAVRQAYVEGLSYLELAQELQVPL 161
159185000 161 NTVRTWLRRSLLKLRECMQR 180
89053139  161 NTMRTWLRRSLLSLKECLSR 180
13474039  160 NTMRTWLRRSLMKLRECLER 179
99077920  165 NTMRTWLHRSLLTLKDCLSR 184
153009024 162 NTVRTWLRRSLLKLRECMQR 181
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap