Conserved Protein Domain Family
PRK12512

?
PRK12512: PRK12512 
RNA polymerase sigma factor; Provisional
Statistics
?
PSSM-Id: 171551
View PSSM: PRK12512
Aligned: 16 rows
Threshold Bit Score: 250.77
Threshold Setting Gi: 16264258
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
182680037   2 TSLEREEEWAEWMRLALAGDGVAYRRVLTAITPYLRATARNRLNRLGLgqqgfGANEAEDIVQEILLAVHLKRHTWDVER 81 
158425107   2 DGSARDQQWSEWMRLALAGDGAAYRRFLSEVTPHLRMLAQRRCRAFGA-----PAGEAEDIVQEVLLAVHLKRGTWDPAR 76 
222087860   1 ------------MRAAIDGDAQAYHRFLSAVAPYLRAMARRRCDQFGA-----PASEAEDVVQEVLLAIHLKRGTWDTSR 63 
115523959   1 -MASGEDEWATSMRAAMAGDAGAYRRFLAAVAPHIRAVARSRCRQFGA-----EA-EIEDVVQEVLLTIHLKRGTWDQAR 73 
90423248    1 -MQGRDEEWTGLMRSANAGDSAAYHRLLKAVTPVLRAAARRGLARAGQ-----PIDQSEDIVQDILLAVHLKKHTWDASA 74 
91976387   10 CVRGRDDEWTDLMRSANAGDGVAYRRLLMAVAPVLRAGARRGLVRAGQ-----PVDQAEDIVQDILLAVHLKRHTWDPSA 84 
86750665    1 -MRGRDDEWTDLMLSANAGDSVAYQRLLKAVTPVLRAGARRGLARAGQ-----PIDQSEDIVQEILLAVHLKRHTWDPEA 74 
192290409   1 -MRGRDDEWTDLMRSANAGDSIAYRRLLESVTPVLRAGARRGLARAGQ-----PVDQAEDIVQDILLAVHLKRQTWDPGA 74 
16264258    1 MNGADDGDLAGLLRTALGGNEKAYSEFLQSAAALVRIWARRRVASVGL--------DPEDIVQETLLAVHLKRHTWRTGG 72 
209885772   1 -MSGQEHEWTDLMRSANAGDAAAYHRLLSAITPVLRASARRGLLRAGQ-----SPDQSEDIVQDTLLAVHLKRHTWDPKA 74 
182680037  82 PIGPWLAAITRHKVVDSLRRRGYRTDVPIEDIAEFLPVETHGDSLDSHDVGRMLDRLNERQRDIVQSISMQGCSVRETAE 161
158425107  77 PIGPWLSAIVRNKLIDSLRRRGREPTTPIEDVMETLEAAPVADGTERLDALQMLGHLRDPQRDIVRSISLEGAGVRETAA 156
222087860  64 PIGPWISTIVRNKLIDSLRRRGRHVNVPIDDVIDSLEADEQTDALDRLDVDRMLAQLRDPQRTIVRSISVDGTSVRETAD 143
115523959  74 PIGPWVAAITRNKVIDVLRRRGRRINVPIEDVIDSLPAEDATPALPARDVETLLGQLKDPQRDIVRSISLNGASIRDTAG 153
90423248   75 PFAPWLFAIARNKLIDALRRRGRRVFVNIDDFAETIPSAPAAETLPTSEIASHLETLPARQRDVLQAIAVDSASIKTTAA 154
91976387   85 PFAPWLFAIARNKLIDALRRRGRRVFVNIDDFAETIPSEQAQETLPAGEVTRHLEALPQRQREVLQSIAVDSVSIKDTAR 164
86750665   75 PFAPWLFAIARNKLIDALRRRGRRVFVNIDDFAETIPSEAAPETLPSGEIARHLEALPQRQREVLQSIAVDSASIKDTAN 154
192290409  75 PFAPWLFAIARNKLIDTLRRRGRRVFVDIDDFADTLASEPAPETLPASEVTRHLEGLPPRQRDVLQSIAVDSASIKDTAA 154
16264258   73 PVKPWLFAIARHKLVDALRRHGRHSRVQLSEIEGNLATEEA-ETARDWEIGRALEVLTPGQRSVVTAISVEGRTIAEAAR 151
209885772  75 PFAPWLFTIARNKLIDALRRRGRRVFVDIDDFTDVLPGEDAPEPANGVDVAAHLQLLPPRQRDVLQAIAVDGLSISETAQ 154
182680037 162 RLSMSEGAVRVALHRALKMLAVLFRSEPA 190
158425107 157 RLKMTEGAVRVALHRALKTLAKIYRSEPH 185
222087860 144 RLKMTEGAVRVALHRALKALAALYRSENS 172
115523959 154 RLKMSEGAVRVALHRALKRLAALYRSSSR 182
90423248  155 KLAITEGAVRVALHRGLSRLASKLRTE-- 181
91976387  165 KLSMSEGAVRVALHRGLSALAAKMRSV-- 191
86750665  155 RLSMSEGAVRVALHRGLAALAAKMRSV-- 181
192290409 155 KLSMSEGAVRVALHRGLSALAAKLRTV-- 181
16264258  152 SLDMNETAVRVALHRGLAAIARRFGRK-- 178
209885772 155 KFTMKEGTVRVALHRGLASLAARAREELP 183
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap