Conserved Protein Domain Family
PRK12492

?
PRK12492: PRK12492 
long-chain-fatty-acid--CoA ligase; Provisional
Statistics
?
PSSM-Id: 171539
View PSSM: PRK12492
Aligned: 17 rows
Threshold Bit Score: 1190.01
Threshold Setting Gi: 162139461
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66047063    1 MQADFWDDKRPAGVDAEVDLQTYQSVVDVFERCCRKFADRPAFSNMGVTLTYAELERHSAAFAAYLQQHTQLVPGDRIAV 80 
77460575    1 MQPDFWNDKRPAGVPLDIDAGEFKSVIEVFERSCKKFADRPAFSNMGVTLTYAELERQSAAFAGYLQAHTDLVPGDRIAV 80 
71736347    1 MQSDFWDDKRPAGVDSEVDLQTYQSVIEVFERCCRKFADRPAFSNMGVTLTYAELERHSAAFAGYLQQHTQLVPGDRIAV 80 
70731941    1 MQPDFWNDKRPAGVPNEIDLGAFKSVIEVFERSCKKFADRPAFSNMGVTLTYAELERYSAAFAGYLQSHTDLVPGDRIAV 80 
15598496    1 MQPEFWNDKRPAGVPDSLDFAAYRSVVEVFERSCKKFADRPAFSNLGVTLSYAELDRLSAAFAAYLQKQTDLQPGDRIAV 80 
28871240    1 MQADFWDDKRPAGVDSNVDLQAYQSVIDVFERCCKKFADRPAFSNMGVTLTYAELDRHSAAFTAYLQQHTQLMPGDRIAV 80 
116051315   1 MQPEFWNDKRPAGVPDSLDFAAYRSVVEVFERSCKKFADRPAFSNLGVTLSYAELDRLSAAFAAYLQKQTDLQPGDRIAV 80 
162139461   1 MQPEFWNDKRPAGVPNDIDLAAYRSVVEVFERACKAHADRPAFSNMGVTLSYSDLERYSAAFAAWLQHHTDLQPGDRIAI 80 
152985850   1 MQPEFWNDKRPAGVPDSLDFAAYRSVVEVFERSCKKFADRPAFSNLGVTLSYAELDRLSAAFAAYLQKHTDLKPGDRIAV 80 
218890506   1 MQPEFWNDKRPAGVPDSLDFAAYRSVVEVFERSCKKFADRPAFSNLGVTLSYAELDRLSAAFAAYLQKQTDLQPGDRIAV 80 
66047063   81 QMPNILQYPIAVFGAMRAGLTVVNTNPLYTAREMRHQFKDSGARALVYLNLFGKLVQEVLPDTAIEYLIEVKMGDMQSAA 160
77460575   81 QMPNVLHYPIAVFGALRAGLIVVNTNPLYTAREMRHQFKDSGARALVYLNMFGQKVQEVLADTDIQYLIEAKMGDLMPTA 160
71736347   81 QMPNILQYPIAVFGAMRAGLIVVNTNPLYTAREMRHQFKDSGARALVYLNLFGKLVQEVLPDTAIEHLIEVKMGDMQSPA 160
70731941   81 QMPNVLQYPIAVFGALRAGLVVVNTNPLYTAREMRHQFKDCGARALVYLNIFGQKVQEVLGDTDIQFLIEARMGDMMPSA 160
15598496   81 QMPNVLQYPIAVFGALRAGLVVVNTNPLYTAREMRHQFKDAGVRALVYLNVFGKLVEEVLPDTRIEYLIEARMGDLLPAL 160
28871240   81 QMPNLLQYPIAVFGAMRAGLIVVNTNPLYTAREMRHQFKDSGAKALVYLNMFGKLVQEVLPDTAIEHLIEVKMGDMQSAA 160
116051315  81 QMPNVLQYPIAVFGALRAGLVVVNTNPLYTAREMRHQFKDAGVRALVYLNVFGKLVEEVLPDTRIEYLIEARMGDLLPAL 160
162139461  81 QMPNLLQYPVAVFGALRAGLIVVNTNPLYTAREMRHQFQDSGARALVYLNTFGNHVQEVLADTVIEHLIEVQIGDMLPTL 160
152985850  81 QMPNVLQYPIAVFGALRAGLIVVNTNPLYTAREMRHQFKDAGVRALVYLNLFGKLVQEVLPDTRIEYLIEARMGDLLPAL 160
218890506  81 QMPNVLQYPIAVFGALRAGLVVVNTNPLYTAREMRHQFKDAGVRALVYLNVFGKLVEEVLPDTRIEYLIEARMGDLLPAL 160
66047063  161 KGWLVNTIVDKVKKMVPEFHLPQAVGFKRALRLGRDSRMQVVPRGLQDVAVLQYTGGTTGLAKGAMLTHGNLVANMQQVY 240
77460575  161 KGWLVNTVVSKVKKMVPAYSLPQAISFKSALRMGRGLGIKPLKVGLDDIAVLQYTGGTTGLAKGAMLTHGNLVANMQQVR 240
71736347  161 KGWLVNTIVDKVKQLVPSFHLPQAVGFKRALRLGRDSRMQVVPRGLDDVAVLQYTGGTTGLAKGAMLTHGNLVANMQQVY 240
70731941  161 KGWLINTVVDKVKKMVPAYHLPQAISFKSALRLGRGQSIKPLQVGHDDVAVLQYTGGTTGLAKGAMLTHGNLVANMQQAR 240
15598496  161 KGWLVNSVVKSVKKMVPDYRLPQALPFRQALKQGQGHALQPVRVGLEDVAVLQYTGGTTGVSKGAMLTHGNLVANMLQVH 240
28871240  161 KGWLVNIIVDKVKKLVPPFRLPQAVGFKRALQLGRDSRVQAVAQTLDDVAVLQYTGGTTGLAKGAMLTHGNLVANMQQVY 240
116051315 161 KGWLVNSVVKSVKKMVPDYRLPQALPFRQALKQGQGHALQPVRVGLEDVAVLQYTGGTTGVSKGAMLTHGNLVANMLQVH 240
162139461 161 RGALVNAAVKHLKKMVPDYSLPQAVAFKNLLRDGARHSLKPTPLSLDDIAVLQYTGGTTGVAKGAMLTHGNLVANMQQVR 240
152985850 161 KGWLVNSVVKSVKKMVPDYQLPQALPFKQALKQGQGHALQPVRVGLEDIAVLQYTGGTTGVSKGAMLSHGNLVANMLQVH 240
218890506 161 KGWLVNSVVKSVKKMVPDYRLPQALPFRQALKQGQGHALQPVRVGLEDVAVLQYTGGTTGVSKGAMLTHGNLVANMLQVH 240
66047063  241 ACMRQQGPRGGSLFEEGKEVMIAPLPLYHIYAFTANCMCMMISGNHNILITNPRDIGGFIKELGKWQFTAMIGLNTLFVA 320
77460575  241 ACLGQFGSDGQPLLREGQEVMIAPLPLYHIYAFTANCMCMMVSGNHNVLITNPRDIGGFIKELKNWKFSALLGLNTLFVA 320
71736347  241 ACMRQQRPEGGSLFEEGTEVMIAPLPLYHIYAFTANCMCMMISGNHNILITNPRDIGGFIKELGKWKFTAMIGLNTLFVA 320
70731941  241 ACLGQHGPDGHTQWREGQEVMIAPLPLYHIYAFTANCMCMMVTGNHNVLITNPRDIGGFIKELKKWRFSALLGLNTLFVA 320
15598496  241 AQLSQLGKDGLPLMKEAQEVMIAPLPLYHIYAFTANCMCMMVSGNHNVLITNPRDIPGFVKELKKWRFSALLGLNTLFVA 320
28871240  241 ACMRQDRPEGGPVFEEGSEVMIAPLPLYHIYAFTANCMCMMISGNHNILITNPRDIAGFIKELGKWKFTAMIGLNTLFVA 320
116051315 241 AQLSQLGKDGLPLMKEAQEVMIAPLPLYHIYAFTANCMCMMVSGNHNVLITNPRDIPGFVKELKKWRFSALLGLNTLFVA 320
162139461 241 ANMQQLDAQGHPVIREGQEVMIAPLPLYHIYAFTVNCMCMMVTGNHNVLITNPRDINGFVKELQRWQFSAFLGLNTLFVA 320
152985850 241 AQLSQLGKDGLPLMKEAQEVMIAPLPLYHIYAFTANCMCMMVSGNHNVLITNPRDIPGFVRELKKWRFSALLGLNTLFVA 320
218890506 241 AQLSQLGKDGLPLMKEAQEVMIAPLPLYHIYAFTANCMCMMVSGNHNVLITNPRDIPGFVKELKKWRFSALLGLNTLFVA 320
66047063  321 LMNHPEFKKLDFSALKSTNSGGTALVKATAERWAQITGCTIVEGYGLTETSPVASANPYGTMARLGTVGIPVPGTAMKVI 400
77460575  321 LMDHPDFKTLDFSTLKLTNSGGTALVKATAERWEQITGCRITEGYGLTETSPVACTNPYGELSRIGTVGLPVPGTLLKVI 400
71736347  321 LMNHPQFRSLDFSALKSTNSGGTALVKATAERWAQITGCTIVEGYGLTETSPVASANPYGTLARLGTVGIPVPGTAMKVI 400
70731941  321 LMDHPDFKNLDFSNLKLTNSGGTALVKATAERWQKLTGCRITEGYGLTETSPVACTNPYGERSRLGTVGLPVPGTTLKII 400
15598496  321 LMEHPGFKDVDFSNLKLTNSGGTALVSATAERWKGVTGCTVVEGYGLTECSPVVTTNPYGEQARLGTVGIPVVGTALKVI 400
28871240  321 LMNHPEFKKLDFSALKSTNSGGTALVKATAERWAQITGCTIVEGYGLTETSPVASANPYGTQARLGTVGIPVPGTAMKVI 400
116051315 321 LMEHPGFKDVDFSNLKLTNSGGTALVSATAERWKGVTGCTVVEGYGLTECSPVVTTNPYGEQARLGTVGIPVVGTALKVI 400
162139461 321 LMAHPQFKKVDFSRLKGTNSGGTALVSAVAERWKSMTGCTVVEGYGLTETSPVVCANPHGEHSRLGTVGLPVPGTTLKVI 400
152985850 321 LMEHPGFKDIDFSNLKLTNSGGTALVSATAERWKGVTGCTVVEGYGLTECSPVVTTNPYGEQARLGTVGIPVVGTALKVI 400
218890506 321 LMEHPGFKDVDFSNLKLTNSGGTALVSATAERWKGVTGCTVVEGYGLTECSPVVTTNPYGEQARLGTVGIPVVGTALKVI 400
66047063  401 DDNGVELPFGERGELCIKGPQVMKGYWNQPDATAECLDAEGWFKTGDIAVIGADGFVSIVDRKKDLIIVSGFNVYPNEIE 480
77460575  401 NDDGVEQPLGERGELCIKGPQIMKGYWNKPEATAEVLDAEGWFKSGDIAVIDPDGFVRIVDRKKDMIIVSGFNVYPNEIE 480
71736347  401 DDDGAELPFGERGELCIQGPQVMKGYWNQPAATAESLDAQGWFKTGDIAVIGTDGFVSIVDRKKDLIIVSGFNVYPNEIE 480
70731941  401 DDQGVELPLGERGELCIKGPQIMKGYWNKPEATAEVLDAEGWFKSGDIAVIDPDGFVRIVDRKKDMIIVSGFNVYPNEIE 480
15598496  401 DEQGNELPVGERGELCVKGPQVMKGYWQRPEATEEILDAEGWLKTGDIAVIDEDGFVRIVDRKKDLILVSGFNVYPNEIE 480
28871240  401 DDEGVELAFGERGELCIKGPQVMKGYWNRPDATAEALDAEGWFKTGDIAVIAADGFVSIVDRKKDLIIVSGFNVYPNEIE 480
116051315 401 DEQGNELPVGERGELCVKGPQVMKGYWQRPEATEEILDAEGWLKTGDIAVIDEDGFVRIVDRKKDLILVSGFNVYPNEIE 480
162139461 401 DDEGNALPLGERGELCVKGPQVMKGYWQRPEATAEVLDEEGWLRTGDIAVIDQDGFVSIVDRKKDLIIVSGFNVYPNEIE 480
152985850 401 DEEGKELPVGERGELCVKGPQVMKGYWQRPEATEEILDAEGWLKTGDIAVIDGDGFVRIVDRKKDLILVSGFNVYPNEIE 480
218890506 401 DEQGNELPVGERGELCVKGPQVMKGYWQRPEATEEILDAEGWLKTGDIAVIDEDGFVRIVDRKKDLILVSGFNVYPNEIE 480
66047063  481 DVVMAHPKVANCACIGVPDERSGEAVKLFVVARDPGLSIEELKAFCKENFTGYKVPRQIVLRDSLPMTPVGKVLRRELRD 560
77460575  481 DVVMAHPKVANCAVIGVPDERSGEAVKLFVVARETGVSLEELKAYCKENFTAYKVPKHIVLRESLPMTPVGKILRRELRD 560
71736347  481 DVVMAHPKVANCACIGVPDERSGEAVKLFVVAREPGLSVEELKAFCKANFTAYKVPRHIVLRESLPMTPVGKILRRELRD 560
70731941  481 DVVMAHPKVANCAVIGIPDERSGEAVKLFVVPREAGVSLEELKAYCKENFTGYKVPKHIVLRDSLPMTPVGKILRRELRD 560
15598496  481 DVVMAHPKVASCAAVGIPDEKSGEAVKLFVVARDPSLSVEELKAYCKENLTGYKIPRQIVLKDALPMTPVGKILRRELRE 560
28871240  481 DVIMTHSKVANCACIGVPDERSGEAVKLFVVPRDPSVSVEELKAFCKENFTAYKVPKLIVLRDSLPMTPVGKILRRELRD 560
116051315 481 DVVMAHPKVASCAAVGIPDEKSGEAVKLFVVARDPSLSVEELKAYCKENLTGYKIPRQIVLKDALPMTPVGKILRRELRE 560
162139461 481 DVVMAHPKVAACAAIGVADEKSGEAVKLFVVPSDPTLTQEELHAYCRENFTGYKMPRHYVFRDALPMTPVGKILRRELRE 560
152985850 481 DVVMAHPKVASCAAVGIPDEKSGEAVKLFVVARDPSLSVEELKAYCKENFTGYKIPRQIVLKDALPMTPVGKILRRELRE 560
218890506 481 DVVMAHPKVASCAAVGIPDEKSGEAVKLFVVARDPSLSVEELKAYCKENLTGYKIPRQIVLKDALPMTPVGKILRRELRE 560
66047063  561 IA 562
77460575  561 IA 562
71736347  561 IA 562
70731941  561 IA 562
15598496  561 IA 562
28871240  561 PA 562
116051315 561 IA 562
162139461 561 SA 562
152985850 561 IA 562
218890506 561 IA 562
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap