Conserved Protein Domain Family
PRK12491

?
PRK12491: PRK12491 
pyrroline-5-carboxylate reductase; Reviewed
Statistics
?
PSSM-Id: 105695
View PSSM: PRK12491
Aligned: 13 rows
Threshold Bit Score: 451.063
Threshold Setting Gi: 217960549
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
47528433    1 MNKQIGFIGCGNMGIAMIGGMINKNIVSPNQIICSDLNVSNLKNASDKYGITITTNNNEVANSADILILSIKPDLYTSVI 80 
30263087    1 MNKQIGFIGCGNMGIAMIGGMINKNIVSPNQIICSDLNVSNLKNASDKYGITITTNNNEVANSADILILSIKPDLYTSVI 80 
49185927    1 MNKQIGFIGCGNMGIAMIGGMINKNIVSPNQIICSDLNVSNLKNASDKYGITITTNNNEVANSADILILSIKPDLYTSVI 80 
30021221    1 MNKQIGFIGCGNMGIAMIGGMIKKNIVSPDQIICSDLNVINLKNASNEYGITITTNNNEVANSADILILSIKPDLYSSVI 80 
49480085    1 MNKQIGFIGCGNMGIAMIGGMINKNIVSPNQIICSDLNVSNLKNASDKYGITITTNNNEVANSADILILSIKPDLYTSVI 80 
52142392    1 MNKQIGFIGCGNMGIAMIGGMIKKNIVSPDQIICSDLNVINLKNASNEYGITITTNNNEVANSADILILSIKPDLYSSVI 80 
118478443   1 MNKQIGFIGCGNMGIAMIGGMINKNIVSPDQIICSDLNVSNLKNASDKYGITITTNNNEVANSADILILSIKPDLYSSVI 80 
218235333   1 ------------MGIAMIGGMIKKNIVFPDQIICSDLNVINLKNASNEYGITITTNNNEVANSADILILSIKPDLYSSVI 68 
217960549   1 ------------MGIAMIGGMIKKNIVSPDQIICSDLNVSNLKNASNEYGITITTNNNEVANSADILILSIKPDLYSSVI 68 
229600273   1 MNKQIGFIGCGNMGIAMIGGMINKNIVSPNQIICSDLNVSNLKNASDKYGITITTNNNEVANSADILILSIKPDLYTSVI 80 
222096609   1 MNKQIGFIGCGNMGIAMIGGMIKKNIVSPDQIICSDLNVINLKNASNEYGITITTNNNEVANSADILILSIKPDLYSSVI 80 
296503651   1 ------------MGIAMIGGMIKKNIVSPDQIICSDLNVINLKNASNEYGITITTNNNEVANSADILILSIKPDLYSSVI 68 
301054631   1 MNKQIGFIGCGNMGIAMIGGMINKNIVSPNQIICSDLNVSNLKNASDKYGITITTNNNEVANSADILILSIKPDLYTSVI 80 
47528433   81 nqikNQIKNQIKNDVIVVTIAAGKSIKSTENEFDRKLKVIRVMPNTPVLVGEGMSALSFNEMVTEKDIKEVLNIFNSFGQ 160
30263087   81 nqikNQIKNQIKNDVIVVTIAAGKSIKSTENEFDRKLKVIRVMPNTPVLVGEGMSALSFNEMVTEKDIKEVLNIFNSFGQ 160
49185927   81 nqikNQIKNQIKNDVIVVTIAAGKSIKSTENEFDRKLKVIRVMPNTPVLVGEGMSALSFNEMVTEKDIKEVLNIFNSFGQ 160
30021221   81 ----NQIKDQIKNDVIVVTIAAGKSIKSTENEFGRKLKVVRVMPNTPALVGEGMSALCFNEMVTEKDIKEVLNIFNIFGQ 156
49480085   81 ----NQIKDQIKNDVIVVTIAAGKSIKSTENEFDRKLKVIRIMPNTPVLVGEGMSALSFNEMVTEKDIKEVLTIFNIFGQ 156
52142392   81 ----NQIKDQIKNDVIVVTIAAGKSIKSTENEFGRKLKVVRVMPNTPALVGEGMSALCFNEMVTEKDIKEVLNIFNIFGQ 156
118478443  81 ----NQIKDQIKNDVIVVTIAAGKSIKSTENEFDRKLKVIRVMPNTPVLVGEGMSALCFNEMVTEKDIKEVLNIFNIFGQ 156
218235333  69 ----NQIKDQIKNDVIVVTIAAGKSIKSTENEFGRKLKVVRVMPNTPALVGEGMSALCFNEMVTEKDIKEVLNIFNIFGQ 144
217960549  69 ----NQIKDQIKNDVIVVTIAAGKSIKSTENEFGRKLKVVRVMPNTPALVGEGMSALCFNEMVTEKDIKEVLNIFNIFGQ 144
229600273  81 nqikNQIKNQIKNDVIVVTIAAGKSIKSTENEFDRKLKVIRVMPNTPVLVGEGMSALSFNEMVTEKDIKEVLNIFNSFGQ 160
222096609  81 ----NQIKDQIKNDVIVVTIAAGKSIKSTENEFGRKLKVVRVMPNTPALVGEGMSALCFNEMVTEKDIKEVLNIFNIFGQ 156
296503651  69 ----NQIKDQIKNDVIVVTIAAGKSIKSTENEFGRKLKVVRVMPNTPALVGEGMSALCFNEMVTEKDIKEVLNIFNIFGQ 144
301054631  81 ----NQIKDQIKNDVIVVTIAAGKSIKSTENEFDRKLKVIRIMPNTPVLVGEGMSALSFNEMVTEKDIKEVLTIFNIFGQ 156
47528433  161 TEVVNEKLMDVVTSISGSSPAYVYMFIEAMADAAVLDGMPRKQAYKFAAQAVLGSAKMVLETGIHPGELKDMVCSPGGTT 240
30263087  161 TEVVNEKLMDVVTSISGSSPAYVYMFIEAMADAAVLDGMPRKQAYKFAAQAVLGSAKMVLETGIHPGELKDMVCSPGGTT 240
49185927  161 TEVVNEKLMDVVTSISGSSPAYVYMFIEAMADAAVLDGMPRKQAYKFAAQAVLGSAKMVLETGIHPGELKDMVCSPGGTT 240
30021221  157 TEVINEKLMDVVTSISGSSPAYVYMFIEAMADAAVLGGMPRKQAYKFAAQAVLGSAKMVLETGIHPGELKDMVCSPSGTT 236
49480085  157 TEVVNEKLMDVVTSISGSSPAYVYMFIEAMADAAVLDGMPRKQAYKFAAQAVLGSAKMVLETGIHPGELKDMVCSPGGTT 236
52142392  157 TEVVNEKLMDVVTSISGSSPAYVYMFIEAMADAAVLGGMPRKQAYKFAAQAVLGSAKMVLETGIHPGELKDMVCSPGGTT 236
118478443 157 TEVVNEKLMDVVTSISGSSPAYVYMFIEAMADAAVLGGMARKQAYKFAAQAVLGSAKMVLETGIHPGELKDMVCSPGGTT 236
218235333 145 TEVINEKLMDVVTSISGSSPAYVYMFIEAMADAAVLGGMPRKQAYKFAAQAVLGSAKMVLETGIHPGELKDMVCSPGGTT 224
217960549 145 TEVVNEKLMDVVTSISGSSPAYVYMFIEAMADAAVLGGMPRKQAYKFAAQAVLGSAKMVLETGIHPGELKDMVCSPGGTT 224
229600273 161 TEVVNEKLMDVVTSISGSSPAYVYMFIEAMADAAVLDGMPRKQAYKFAAQAVLGSAKMVLETGIHPGELKDMVCSPGGTT 240
222096609 157 TEVVNEKLMDVVTSISGSSPAYVYMFIEAMADAAVLGGMPRKQAYKFAAQAVLGSAKMVLETGIHPGELKDMVCSPGGTT 236
296503651 145 TEVINEKLMDVVTSISGSSPAYVYMFIEAMADAAVLGGMPRKQAYKFAAQAVLGSAKMVLETGIHPGELKDMVCSPSGTT 224
301054631 157 TEVVNEKLMDVVTSISGSSPAYVYMFIEAMADAAVLDGMPRKQAYKFAAQAVLGSAKMVLETGIHPGELKDMVCSPGGTT 236
47528433  241 IEAVATLEEKGLRTAIISAMKRCTKKSMEMSRLTSK 276
30263087  241 IEAVATLEEKGLRTAIISAMKRCTKKSMEMSRLTSK 276
49185927  241 IEAVATLEEKGLRTAIISAMKRCTKKSMEMSRLTSK 276
30021221  237 IEAVVTLEEKGLRTAIISAMKRCTQKSMEMSSLTSK 272
49480085  237 IEAVATLEEKGLRTAIISAMKRCTKKSMEMSSLTSK 272
52142392  237 IEAVVTLEEKGLRTAIISAMKRCMQKSMEMSSLTSK 272
118478443 237 IEAVAILEAKGLRTAIISAMKRCTQKSMEMSSLTSK 272
218235333 225 IEAVVTLEEKGLRTAIISAMKRCTQKSMEMSSLTSK 260
217960549 225 IEAVVTLEEKGLRTAIISAMKRCMQKSMEMSSLTSK 260
229600273 241 IEAVATLEEKGLRTAIISAMKRCTKKSMEMSRLTSK 276
222096609 237 IEAVVTLEEKGLRTAIISAMKRCMQKSMEMSSLTSK 272
296503651 225 IEAVVTLEEKGLRTAIISAMKRCTQKSMEMSSLTSK 260
301054631 237 IEAVATLEEKGLRTAIISAMKRCTKKSMEMSSLTSK 272
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap