Conserved Protein Domain Family
PRK12485

?
PRK12485: PRK12485 
bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II
Statistics
?
PSSM-Id: 171535
View PSSM: PRK12485
Aligned: 11 rows
Threshold Bit Score: 750.639
Threshold Setting Gi: 104782100
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
26990518    1 MAFNTIEELLEDYRQGKMVLLVDDEDRENEGDLLIAAERCDAQAINFMAREARGLICLTLTDDHCQRLGLEQMVPANGSV 80 
77459462   14 MAFNSIEEIIEDYRLGKMVLLVDDEDRENEGDLLLAADRCTPEAISFMAREARGLICLTLTDDHCQRLGLEQMVPSNGSV 93 
71737414    1 MAFDRIEDIIEDYRQGKMVLLVDDEDRENEGDLLLAADCCSAQAISFMAREARGLICLTLTDEHCQRLGLEQMVPSNGSV 80 
66045638    1 MAFDRIEDIIEDYRQGKMVLLVDDEDRENEGDLLLAADCCSPQAISFMAREARGLICLTLTDEHCQRLGLEQMVPSNGSV 80 
28869856    1 MAFDRIEDIIEDYRQGKMVLLVDDEDRENEGDLLLAADCCTAQAISFMAREARGLICLTLTDEHCKSLGLEQMVPSNGSV 80 
104782100   1 MAFNSIEELLEDYRQGRMVLLVDDEDRENEGDLLIAAERCDALAINFMAREARGLICLTLTDEHCQRLGLEQMVPSNGSV 80 
148547181   1 MAFNTIEELLEDYRQGKMVLLVDDEDRENEGDLLIAAERCDAQAINFMAREARGLICLTLTDDHCQRLGLEQMVPANGSV 80 
146308463   1 MPFNPIEEIIEDFRQGKMVLLVDDEDRENEGDLLLAAEKCTPEAINFMAREARGLICLTLTDEHCQRLGLEQMVPANGSA 80 
167033098   1 MAFNTIEELLEDYRQGKMVLLVDDEDRENEGDLLIAAERCDAQAINFMARQARGLICLTLTDEHCQRLGLEQMVPANGSV 80 
170721120   1 MAFNTIEELLEDYRQGKMVLLVDDEDRENEGDLLIAAERCDAQAINFMAREARGLICLTLTDEHCQRLGLEQMVPANGSA 80 
229589830   1 MSFNSIADIIEDYRQGKMVLLVDDEDRENEGDLLLPAACCTAETISFMAREARGLICLTLTDEHCQRLGLEQMVPSNGSV 80 
26990518   81 FSTAFTVSIEAATGVTTGISAADRARTVAAAMAPNARPEDLVQPGHIFPLRAREGGVLTRAGHTEAGCDLARLAGFSPAS 160
77459462   94 FSTAFTVSIEAAVGVTTGISAADRACTVAAAVAPNARAEDLVQPGHIFPLRAKEGGVLTRAGHTEAGCDLARLVGFTPAS 173
71737414   81 FATAFTVSIEATMGVTTGISAADRARTVQAAVNPHAVREDLVQPGHIFPLRARDGGVLTRAGHTEAGCDLARMAGFSPAS 160
66045638   81 FATAFTVSIEATTGVTTGISAADRARTVQAAVNPHAVPEDLVQPGHIFPLRARDGGVLTRVGHTEAGCDLARLAGFTPAS 160
28869856   81 FATAFTVSIEATTGVTTGISAADRARTVQAAVNPGAVPDDLVQPGHIFPLRARDGGVLTRAGHTEAGCDLARMAGFTPAS 160
104782100  81 FSTAFTVSIEAASGVTTGISAADRARTVAAAMAADARPEDLVQPGHIFPLRAREGGVLTRAGHTEAGCDLARLAGFSPAS 160
148547181  81 FSTAFTVSIEAATGVTTGISAADRARTVAAAMAPNARPEDLVQPGHIFPLRAREGGVLTRAGHTEAGCDLARLAGFSPAS 160
146308463  81 FATAFTVSIEAAQGVTTGISAADRCLTVLTAVAPEACADDLVQPGHIFPLRAREGGVLTRAGHTEAGCDLARLAGLSPAA 160
167033098  81 FSTAFTVSIEAATGVTTGISAADRARTVAAAMAPNAHPEDLVQPGHIFPLRAREGGVLTRAGHTEAGCDLARLAGFSPAS 160
170721120  81 FSTAFTVSIEAATGVTTGISAADRARTVAAAMAADARPEDLVQPGHIFPLRAREGGVLNRAGHTEAGCDLARLAGFAPAS 160
229589830  81 FSTAFTVSIEAASGVTTGISAADRARTVAAAVDVNAGPADIVQPGHIFPLRAKYGGVLTRAGHTEAGCDLARLAGHTPAS 160
26990518  161 VIVEVLNDDGTMARRPDLEVFAARHGIKIGTIADLIHYRLSTEQTVKRIGERELPTVHGTFRLVTYEDRIEGGVHMAMVM 240
77459462  174 VIVEVMNDDGTMARRPDLEVFAHKHGIKIGTIADLIHYRLSTEHTIERIGERELPTVHGTFRLITFEDRIEGGVHMAMVM 253
71737414  161 VIVEVMNDDGTMARRPDLELFAEKHGIRIGTIADLIHYRLSTEHTIVRIGERDLPTVHGTFHLFSYEDRIEGGVHMAMVM 240
66045638  161 VIVEVMNDDGSMARRPDLEVFAKKHGIRIGTIADLIHYRLSTEHTIVRIGERELPTVHGTFRLFSYEDRIEGGVHMAMVM 240
28869856  161 VIVEVMNDDGTMARRPDLELFAEKHGIRIGTIADLIHYRLSTEHTIVRIGERELPTVHGTFRLFSYEDRIEGGVHMAMVM 240
104782100 161 VIVEVLNDDGTMARRPDLEVFAARHGIKIGTIADLIHYRLSTEQTIKRIGERELPTVHGTFRLVTYEDHIEGGVHMAMVM 240
148547181 161 VIVEVLNDDGTMARRPDLEVFAARHGIKIGTIADLIHYRLSTEQTIKRIGERELPTVHGTFRLVTYEDRIEGGVHMAMVM 240
146308463 161 VIVEVMNEDGSMARRPDLETFAEKHGIKIGTIADLIHYRLSTEHTVSRIGERELPTVHGTFRLVTYEDRIEGGVHMAMVM 240
167033098 161 VIVEVLNDDGTMARRPDLEVFAAQHGIKIGTIADLIHYRLSTEQTIKRIGERELPTVHGIFRLVSYEDRIEGGVHMAMVM 240
170721120 161 VIVEVLNDDGTMARRPDLEVFAARHGIKIGTIADLIHYRLSTEQTIKRIGERELPTVHGTFRLVTYEDRIEGGVHMAMVM 240
229589830 161 VIVEVMNDDGTMARRPELEIFARKHGIKIGTIADLIHYRLSTERTVVRIGERDLPTVHGTFRLITFEDRIDGGVHMAMVM 240
26990518  241 GDIRREQPTLVRVHVIDPLRDLVGAEYAGPANWTLWAALQKVAEEGTGVVVILANHESSQALLERVPQLTHPVRPYQRGQ 320
77459462  254 GELRREEPTLVRVHVIDPLRDLVGAEYSGPTNWTLWAALQRVAAEGHGVVVVLANHESSQALLERIPQLTQPPRQFSRSQ 333
71737414  241 GDIRRDDPTLVRVHVVDPLRDLVGAEYTGPSNWTLWAALQRVAQEGRGVVVVLANHESSQALLERIPQLTQPPRQYTRSQ 320
66045638  241 GDIRRDAATLVRVHVVDPLRDLVGAEYNGPANWTLWAALQRVAQEGHGVVVVLANHESSQALLERIPQLTQPPRQYTRSQ 320
28869856  241 GDIRREDPTLVRVHVVDPLRDLVGAEYTGPANWTLWAALQRVAEEGCGVVVVLANHESSQALLERIPQLTQPPRQYTRSQ 320
104782100 241 GDIRREQPTLVRVHVIDPLRDLVGAEYAGPANWTLWAALQKVAEEGAGVVVILANHESSQALLERVPQLTQPMRPYQRGQ 320
148547181 241 GDIRREQPTLVRVHVIDPLRDLVGAEYAGPANWTLWAALQKVAEEGTGVVVILANHESSQALLERVPQLTHPVRPYQRGQ 320
146308463 241 GDIRRDEATLVRVHVIDPLRDLVGAEYNGPQNWTLWAALQKVAEAGHGVVVVLANNESSQALLERVPQLTQARRQFSRSQ 320
167033098 241 GDIRREQPTLVRVHVIDPLRDLVGAEYAGPANWTLWAALQKVAEEGAGVVVILANHESSQALLERIPQLTQPVRPYQRGQ 320
170721120 241 GDIRREQPTLVRVHVIDPLRDLVGAEYAGPANWTLWAALQKVAEEGSGVVVILANHESSQALLERIPQLTQPLRPYQRGQ 320
229589830 241 GQLRRDTPALVRVHVIDPLRDLVGADYSGPSNWTLWAALQRVAAEGSGVVVVLANHESSQALLERVPQLTQAPRQFNRSQ 320
26990518  321 SKVYSEVGTGAQILQDLGVGKLRHLGPPLKYAGLAGYELEVVQSIPFDP 369
77459462  334 SRIYSEVGTGAQILQNLGVGKLRHLGPPLKYAGLTGYDLEVVESIPFTE 382
71737414  321 SRIYSEVGTGAQILQDLGVGKLRHLGPPLKYAGLTGYDLEVIENIPFPG 369
66045638  321 SRIYSEVGTGAQILQDLGVGKLRHLGPPLKYAGLTGYDLEVIESIPFPG 369
28869856  321 SRIYSEVGTGAQILQDLGIGKLRHLGPPLKYAGLTGYDLEVIESIPFPG 369
104782100 321 SKVYSEVGTGAQILQDLGVGKLRHLGPPLKYAGLAGYELEVVQSIPFEG 369
148547181 321 SKVYSEVGTGAQILQDLGVGKLRHLGPPLKYAGLAGYELEVVQSIPFDP 369
146308463 321 SRIYSEVGTGAQILQDLGVGKLRHLGPPLKYAGLTGYDLEVVESIPFQG 369
167033098 321 SKVYSEVGTGAQILQDLGVGKLRHLGPPLKYAGLAGYELEVVQSIPFEP 369
170721120 321 SKVYSEVGTGAQILQDLGVGKLRHLGPPLKYAGLAGYELEVVQSIPFEP 369
229589830 321 SRIYSEVGTGAQILQDLGVGKLRHLGPPLKYAGLTGYDLEVTESIPFTE 369
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap