Conserved Protein Domain Family
PRK12482

?
PRK12482: PRK12482 
flagellar motor stator protein MotA
Statistics
?
PSSM-Id: 171532
View PSSM: PRK12482
Aligned: 19 rows
Threshold Bit Score: 453.436
Threshold Setting Gi: 153947051
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
45442812    1 MQKLFGLLVIMGCVIGGYLMSGGSLSSFWQPGEIIIIFGSGIGALILGNPGSVLQEMWHQILAVARRSEYTVEFQQQlLL 80 
34498444    1 MQQLFGILIVLVCVFGGFMLHGGVLSIIWQPTELLIICGAALGAVVLGNPPHVLKEMGGQIKRVVVRKKQGAEFQRQ-QL 79 
83717992    1 MQLAIGILLVFGCVFGGFVLHGGALSSIWQPTEILIISGAAAGALVMGNPRSVLSEMGSQIKHVIARKSNGVEFQRE-LL 79 
146305233   1 MQKLLGALIIVGCVLGGYVMAHGELAMLWQPAEVVIIVGAGLGALVVGNPKEVLVEMCQQIKGVFVYKRRGEEFQRQ-LL 79 
170021343   1 MQKILGLLVVLGCVFGGYFEAGGQLVAIWQPAEMIIILGAGFGAMIIGNPKHVLKEIAHQIKGVISKKQLGPEFQRQ-LL 79 
170681048   1 MQKILGLLVVLGCVFGGYFEAGGQLVAIWQPAEMIIILGAGFGAMIIGNPKHVLKEIAHQIKGVISKKQLGPEFQRQ-LL 79 
218703544   1 MQKILGLLVVLGCVFGGYFEAGGQLVAIWQPAEMIIILGAGFGAMIIGNPKHVLKEIAHQIKGVISKKQLGPEFQRQ-LL 79 
260853483   1 MQKILGLLVVLGCVFGGYFEAGGQLVAIWQPAEMIIILGAGFGAMIIGNPKHVLKEIAHQIKGVISKKQLGPEFQRQ-LL 79 
260866429   1 MQKILGLLVVFGCVFGGYFEAGGQLVAIWQPAEMIIILGAGFGAMIIGNPKHVLKEIAHQIKGVISKKQLGPEFQRQ-LL 79 
283784103   1 MQKVLGLLVVLGCVFGGYFEAGGQLIAIWQPAEIVIILGAGFGAMIIGNPKHVLKEIAHQIKGVIGKKQLGPEFQRQ-LL 79 
45442812   81 LLLYELLEMVDEGGLKRLDEHIEIPANSSVFQRYPLILQDLHLITFISDNFRLMAMGKINQHELESILEQELSAVEEELL 160
34498444   80 LLMYELL-ITASRGLKALDQHVEAPRQSPLFNRYPMVLENRKLLAFIVDNFRLMAMGKINAHELEGVLDQELDAIHEQLM 158
83717992   80 LMLYELLETVRDGGLKALDQHVEEPKESDLFRKYPMILAQPRLIAFIVDNFRLMAMGRITQHELEGMLDQELEAIESELM 159
146305233  80 MLLYELLEMVEVGGLKVLDAHIEEPEQSELFAKYPLIRQEKNLMAFIADNFRLMAMGKISAHELEGFLEQELEAMEHILL 159
170021343  80 MCLYELLEMVQNGGLRMLDQHIEQPEESTIFQKYPLVLTQKRLVTFIADNFRLMAMGKIDAHELEGILDQELDTAEESLL 159
170681048  80 MCLYELLEMVQNGGLRMLDQHIEQPEESTVFQKYPLVLTQKRLVTFIADNFRLMAMGKIDAHELEGILDQELDTAEESLL 159
218703544  80 MCLYELLEMVQNGGLRMLDQHIEQPEESTIFQKYPLVLTQKRLVTFIADNFRLMAMGKIDAHELEGILDQELDTAEESLL 159
260853483  80 MCLYELLEMVQNGGLRMLDQHIEQPEESTIFQKYPLVLTQKRLVTFIADNFRLMAMGKIDAHELEGILDQELDTAEESLL 159
260866429  80 MCLYELLEMVQNGGLRMLDQHIEQPEESTIFQKYPLVLTQKRLVTFIADNFRLMAMGKIDAHELEGILDQELDTAEESLL 159
283784103  80 MCLYELLEMVQNGGLRMLDQHIEQPEESTVFQKYPQVLTQKRLVTFIADNFRLMAMGKIDAHELEGILDQELDTVEEELL 159
45442812  161 VPSRSFQRIGEAMPGFGICAAVLGIIITMQSI--DGSIAMIGIKVAAALVGTFLGVFICYCLMDPLSNAMEQEIKKKLAL 238
34498444  159 QPSKSLHKIAEAMPGFGILAAVLGIVMAMNTVaqGASAGEIAASVAAAMVGTFIGIFFCYGVLDPLSNVMHQLVKEELSN 238
83717992  160 QPSRSLSKIAESMPGFGILAAVLGIVTTMANI--GGSVSEIGLQVAAAMVGTFIGILLCYGVLEPLASAMVHRVKSDMSA 237
146305233 160 QPSRSLHKIGEAMPGFGILAAIMGIIITMGNI--GGSVAEIGAHVAAALVGTFLGIFMCYCVMEPLSNAMSQRIKTELSA 237
170021343 160 TPSRSLQRTAEAMPGFGICAAVLGIIITMQSI--DGSIALIGLKVAAALVGTFLGVFICYCLMDPLANAMEQQARAEHSL 237
170681048 160 TPSRSLQRTAEAMPGFGICAAVLGIIITMQSI--DGSIALIGLKVAAALVGTFLGVFICYCLMDPLANAMEQQARAEHSL 237
218703544 160 TPSRSLQRTAEAMPGFGICAAVLGIIITMQSI--DGSIALIGLKVAAALVGTFLGVFICYCLMDPLANAMEQQARAEHSL 237
260853483 160 TPSRSLQRTAEAMPGFGICAAVLGIIITMQSI--DGSIALIGLKVAAALVGTFLGVFICYCLMDPLANAMEQQARAEHSL 237
260866429 160 TPSRSLQRTAEAMPGFGICAAVLGIIITMQSI--DGSIALIGLKVAAALVGTFLGVFICYCLMDPLANAMEQQARAEHSL 237
283784103 160 APSRSLQRTAEAMPGFGICAAVLGIIITMQSI--DGSIALIGLKVAAALVGTFLGVFFCYCLMDPLANSMEQQARAEHSL 237
45442812  239 FECVRMVLVNHVAGKPSLLAVDAGRKMLPMDNKPTFATLDSWINKLITAG 288
34498444  239 FESVKVVLTTHVSGKPPLLAIDAGRRLVQLNTKPSFSQLESWINAMEGLG 288
83717992  238 LECVKVVLCAQVAGKPTLLAVDAGRKLIQLDVKPSFSKLESWIMEI---- 283
146305233 238 LECVRTTLVAHVAGKPTLLAVDAGRKLIEQDVKPAFKQLETWVNRYEDER 287
170021343 238 LECVRTVLVAQAGGKPTLLAVDAGRKLLHLASKPTFANLDAWVNAMLEQE 287
170681048 238 LECVRTVLVAQAGGKPTLLAVDAGRKLLHLASKPTFANLDAWVNAMLEQE 287
218703544 238 LECVRTVLVAQAGGKPTLLAVDAGRKLLHLASKPTFANLDAWVNAMLEQE 287
260853483 238 LECVRTVLVAQAGGKPTLLAVDAGRKLLHLASKPTFANLDAWVNAMLEQE 287
260866429 238 LECVRTVLVAQAGGKPTLLAVDAGRKLLHLASKPTFANLDAWVNAMLEQE 287
283784103 238 LECVRTVLVAQAGGKPTLLAVDAGRKLLHLASKPTFANLDAWVNAMLEQE 287
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap