Conserved Protein Domain Family
PRK12481

?
PRK12481: PRK12481 
2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD
Statistics
?
PSSM-Id: 171531
View PSSM: PRK12481
Aligned: 18 rows
Threshold Bit Score: 443.963
Threshold Setting Gi: 37677276
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
27367482    3 LEAFNLDGKVALVTGCNTGLGKGMAVALAQAGCDIVGVNYAGPDETPALIEATGRRFYSIVADLSDASVIASVVDRAVTQ 82 
108806428   1 MQPFDLNGKVAIITGCNTGLGQGMAIGLAKAGADIVGVGVAEAPETQAQVEALGRKFHFITADLIQQKDIDSIVSQAVEV 80 
22127100    1 MQPFDLNGKVAIITGCNTGLGQGMAIGLAKAGADIVGVGVAEAPETQAQVEALGRKFHFITADLIQQKDIDSIVSQAVEV 80 
54301829   23 MNMFDLSGKVAIVTGCNTGLGQGMALGLAKAGANIVGIGHQPAPETQEQVEALGCKFHYITANLMAQDKLEAIVAEAVEV 102
108813201   1 MQPFDLNGKVAIITGCNTGLGQGMAIGLAKAGADIVGVGVAEAPETQAQVEALGRKFHFITADLIQQKDIDSIVSQAVEV 80 
153948238   1 MQLFDLKGKVAIITGCNTGLGQGMAIGLAKAGADIVGVGVAEAPETQAQVEALGRKFHFITADLIQQKDIDSIVSQAVEV 80 
197336885   1 MKLFDLTGKVAIVTGCNTGLGQGMALGLAKAGADIVGVGHQVAPETEEQVKALGRKFHYITANLMKQEGLEELVAEAVEV 80 
197285979   1 MNLFDLTGKVAIVTGCNTGLGQGMAIGLAQAGADIVGVGIQDAPETRQKVEALGRRFHYITQNLIQQDGLDALVDEAVKV 80 
59714180    1 MKLFDLTGKVAIVTGCNTGLGQGMALGLAKAGADIVGVGHQAAPETEEQVKALGRKFHYITANLMKQEGLEELVAEAVEV 80 
218928015   1 MQPFDLNGKVAIITGCNTGLGQGMAIGLAKAGADIVGVGVAEAPETQAQVEALGRKFHFITADLIQQKDIDSIVSQAVEV 80 
27367482   83 AGRIDILVNNAGIIRREDAINFSEQDWDDVMNLNAKSVFFLAQAVARQFQAQQSGGKIINIASMLSFQGGIRVPSYTASK 162
108806428  81 MGHIDILINNAGIIRRQDLLEFGNKDWDDVININQKTVFFLSQAVAKQFVKQGNGGKIINIASMLSFQGGIRVPSYTASK 160
22127100   81 MGHIDILINNAGIIRRQDLLEFGNKDWDDVININQKTVFFLSQAVAKQFVKQGNGGKIINIASMLSFQGGIRVPSYTASK 160
54301829  103 MGQVDILINNAGIIRREDILEFSEENWDDVININQKTLFFLSQSVAKQFVKQGNGGKIINIASMLSFQGGIRVPSYTASK 182
108813201  81 MGHIDILINNAGIIRRQDLLEFGNKDWDDVININQKTVFFLSQAVAKQFVKQGNGGKIINIASMLSFQGGIRVPSYTASK 160
153948238  81 MGHIDILINNAGIIRRQDLLEFGNKDWDDVININQKTVFFLSQAVAKQFVKQGNGGKIINIASMLSFQGGIRVPSYTASK 160
197336885  81 MGHVDILINNAGIIRREDLLKFSEQDWDDVININQKTLFFLSQKVAKQFVKQGNGGKIINIASMLSYQGGIRVPSYTASK 160
197285979  81 MGRIDILVNNAGIIRREDLLQFSEKDWDDVININQKTLFFLSQKVARQFVKQGEGGKIINIASMLSYQGGIRVPSYTASK 160
59714180   81 MGHVDILINNAGIIRREDLLKFSEQDWDDVININQKTLFFLSQKVAKQFVKQGNGGKIINIASMLSYQGGIRVPSYTASK 160
218928015  81 MGHIDILINNAGIIRRQDLLEFGNKDWDDVININQKTVFFLSQAVAKQFVKQGNGGKIINIASMLSFQGGIRVPSYTASK 160
27367482  163 SAVMGITRLLANEWASQGINVNAIAPGYMATNNTAALRADAERNQAILERIPAQRWGLPSDLAGPVVFLASSASDYVNGY 242
108806428 161 SAVMGLTRALATELSQYNINVNAIAPGYMATDNTAALRADTARNEAILERIPASRWGTPDDLAGPAIFLSSSASDYVTGY 240
22127100  161 SAVMGLTRALATELSQYNINVNAIAPGYMATDNTAALRADTARNEAILERIPASRWGTPDDLAGPAIFLSSSASDYVTGY 240
54301829  183 SAVMGLTRALATELAEHKINVNAIAPGYMATDNTEALRADEARNAAILERIPANRWGLPSDLEGPAVFLASSASDYINGY 262
108813201 161 SAVMGLTRALATELSQYNINVNAIAPGYMATDNTAALRADTARNEAILERIPASRWGTPDDLAGPAIFLSSSASDYVTGY 240
153948238 161 SAVMGLTRALATELSQYNINVNAIAPGYMATDNTAALRADTARNEAILERIPASRWGTPDDLAGPAIFLSSSASDYVTGY 240
197336885 161 SAVMGLTRALATELAEHNINVNAIAPGYMATDNTAALRADEDRNAAILERIPANRWGLPSDLEGPAIFLASPASDYINGY 240
197285979 161 SAVMGLTRALATELSQYNINVNAIAPGYMATDNTAALRADEARNAAILERIPAGRWGTPEDVAGPAIFLASKASDYINGY 240
59714180  161 SAVMGLTRALATELAEHNINVNAIAPGYMATDNTAALRADEDRNAAILERIPANRWGLPSDLEGPAIFLASPASDYINGY 240
218928015 161 SAVMGLTRALATELSQYNINVNAIAPGYMATDNTAALRADTARNEAILERIPASRWGTPDDLAGPAIFLSSSASDYVTGY 240
27367482  243 TIAVDGGWLAR 253
108806428 241 TLAVDGGWLAR 251
22127100  241 TLAVDGGWLAR 251
54301829  263 TIAVDGGWLAR 273
108813201 241 TLAVDGGWLAR 251
153948238 241 TLAVDGGWLAR 251
197336885 241 TIAVDGGWLAR 251
197285979 241 TIAVDGGWLAR 251
59714180  241 TIAVDGGWLAR 251
218928015 241 TLAVDGGWLAR 251
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap