Conserved Protein Domain Family
PRK12476

?
PRK12476: PRK12476 
putative fatty-acid--CoA ligase; Provisional
Statistics
?
PSSM-Id: 171527
View PSSM: PRK12476
Aligned: 23 rows
Threshold Bit Score: 1034.69
Threshold Setting Gi: 118467833
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
118618331   1 MNDGSRQDSAAPKGLLEIEDCLDAGGNIELPPGTTLISLIERNIANVGDSVAYRYLDHNRTAQGHALEVTWSEFGVRLQA 80 
108800833   1 MSGGTGQ--MVHEGLLKIEDCLDAAGNIVLPPGVTLISLIERNIAAVGDAVAYRYLDHTGTDEVRVAELTWTELGVRLRA 78 
120404573   1 -----------MSPILRLDDYLDREGNIAIPAGVTLTAFLARNVAELGEAPAYRYLDFDHD---CTVELSWTQLGARLSA 66 
118472159   1 MDSGSRTQYEAPTGLLRIEDCLDADGGIVLPPGTTLISLIERNIANVGDSVAYRYLDYSHGELQVA-ELTWRQLGVRLRA 79 
119869973   1 MSGGTGQ--MVHEGLLKIEDCLDAAGNIVLPPGVTLISLIERNIAAVGDAVAYRYLDHTGTDEVRVAELTWTELGVRLRA 78 
118473450   1 ---------------MKIEDYLDADGNIAIPDGVTLTSYFDRNVAELADTPAYRYLDFEHD--GRVVELTWKELDTRVRA 63 
118467833   1 --MGRVSSGSTVAHSSSIEDYLRSDGTIVVPDGVTLTSFLDRNRAIYGDRPSYRFIDYSHDPDGQAVELSWNALWAQVCA 78 
126436431   1 MSGGTGQ--MVHEGLLKIEDCLDAAGNIVLPPGVTLISLIDRNIAAVGDAVAYRYLDHTGTDEVRVAELTWTELGVRLRA 78 
145223488   1 -----------MSPELRLDDYLDHEGNIVIPPGTTLTSFLGRNAAEFGDTPAYRYLDFEHD---RTIELTWAQLRTRLDA 66 
169628580   1 --------MVRSDGLLDIDDCLNADGNIELPPGTTLISLIDRNIRNVGDMVAYRYLDFTASEDGHAIELTWSQLGIRLSA 72 
118618331  81 IGAHVQKFAGDGDRVAILAPQGIDYVAGFYAAIKAGTIAVPLFAPELPGHAERLDTALRDSEPTVVLTTGAAKPAIEEFL 160
108800833  79 VGARIQQLTSRGDRVAILAPQGLDWVTGFFAAIKAGTIAVPLFAPELQGHAERLRTALEDARPTVVLTTSAAAGAVEGFL 158
120404573  67 VGARLQQVTQRGDRVAVLTPQGVEYVVGFFAAILAGAIAVPLFAPELPGHTDRLDAVLKDAEPSVVLTTTAAAQPVRDFI 146
118472159  80 VGAAVQQVAARGDRVAVLAPQGLDYVIGFFAAIKAGTIAVPLFAPELQGHAERLDTALSDARPTTVLTTAAVEEAVTGFL 159
119869973  79 VGARIQQLTSRGDRVAILAPQGLDWVTGFFAAIKAGTIAVPLFAPELQGHAERLRTALEDARPTVVLTTSAAAGAVEGFL 158
118473450  64 VGARLQQVTKLGDRVAILCPQGVDYVVSFFAAIQAGAIAVPLFSPELPGHAERLEAVLADATPSVVLTTTAAAEAVGAFV 143
118467833  79 VGARLQQVTRPRDRVAILTPQGVDYVAAFFAAIHAGNVAVPLFAPSLAGHTERLAAVLADARPTVVLTTTAASESVRKFL 158
126436431  79 VGARIQQLTSRGDRVAILAPQGLDWVTGFFAAIKAGTIAVPLFAPELQGHAERLRTALEDARPTVVLTTSAAAGAVEGFL 158
145223488  67 VGARLQQVTRPGDRVAILTPQGVEYVIGFFAAIEAGAIAVPLFAPELPGHSERLHAVLADAQPSVVLTTTATAEPVREFL 146
169628580  73 VAAQLQRHVTRGERVAILAPQGLDYIVGFFSAIKAGAIAVPLFAPELPGHAERLDIALRDCTPTVVLTTAAVRDTVEEFL 152
118618331 161 ANLSHLRRPHIITIDDVPDSAGESFVPVELDIDAVSHLQYTSGSTRPPVGVEITHRAVGTNLVQMILSIDLLNRNTHGVS 240
108800833 159 ADLVGVTRPHVVLIDDIPDSAGESFVTTPIDVDDVSHLQYTSGATRPPAGVEITHRAVGTNLLQMILSIDLLDRNTHGVS 238
120404573 147 RKLPRDRRPRIIAVDAVPDSVGTDFTPAPLQTDDIAYLQYTSGSTRAPAGVEITHRSACTNIVQMVLSVG-LDPDIQSVS 225
118472159 160 DKLSG-KQPHVVVIDEVPDSAGADFAPVPVDVDDVSHLQYTSGSTRPPVGVEITHRAVGTNLLQMILSIDLLNRNTHGMS 238
119869973 159 ADLVGVTRPHVVLIDDIPDSAGESFVTTPIDVDDVSHLQYTSGATRPPAGVEITHRAVGTNLLQMILSIDLLDRNTHGVS 238
118473450 144 RKLPHAGRPRMIAVDAVPAAVGATFTPAQLHTDGIAYLQYTSGSTRTPAGVEITHRGVCTNVLQMIISVG-LDWNIRSVS 222
118467833 159 RTLPAAERPRMIAVDAVPTTLADMFTAPEVDTDDVAYLQYTSGSTRTPAGVEITHRNVCTNVLQMILAGD-LEMGIRSVS 237
126436431 159 ADLVGVTRPHVVLIDDIPDSAGESFVTTPIDVDDVSHLQYTSGATRPPAGVEITHRAVGTNLLQMILSIDLLDRNTHGVS 238
145223488 147 RALPHNRRPRLIAVDAVPDSVGVGFQRAPLQTDDVAYLQYTSGSTRAPAGVKITHRSACTNVVQMVLSVG-LDPDINSVS 225
169628580 153 DGRP--EAPLVLAIDEIPDEAGEGFEYVHLVDDDVSHLQYTSGATRPPVGVEITHRAVGVNLTQMILSINLLDRNTHGCS 230
118618331 241 WLPLYHDMGLSMIGFPAVYGGHSTLMSPTAFVRRPQRWIHALSAGSRTGRVVTAAPNFAYEWAAQRGLLTPGDDVDLSNV 320
108800833 239 WLPLFHDMGLSMIGFPAVYGGHSTLMSPTAFLRRPQRWIRALSEGSRQGRVVTAAPNFAFEWTAQRGLPDEGEDIDLGNV 318
120404573 226 WLPLFHDMGLLMIMFPAVAGGHLTLMSPVAFVRRPYRWIKEL--GATDAPTFAAAPNFAFELAAERGLPPAGDTLDLSNV 303
118472159 239 WLPLYHDMGLSMIGFPAVYGGHSTLMSPTAFIRRPQRWIQALSDESRFGRVITAAPNFAYEWTAQRGVPEHGDEIDLSNV 318
119869973 239 WLPLFHDMGLSMIGFPAVYGGHSTLMSPTAFLRRPQRWIRALSEGSRQGRVVTAAPNFAFEWTAQRGLPDEGEDIDLGNV 318
118473450 223 WLPLFHDMGLLMIMFPALCGGHITLMSPVSFVRRPYRWIKEL--GASDVPTFAAAPNFAYELAAHRGLPPAGDELDLSNV 300
118467833 238 WLPLYHDMGLIMIMFPALCGNHITLMDPMAFVRRPYRWIKQLGIEAAYGRTLAAAPNFAYELAAERGLPPSGDALDLSNV 317
126436431 239 WLPLFHDMGLSMIGFPAVYGGHSTLMSPTAFLRRPQRWIRALSEGSRQGRVVTAAPNFAFEWTAQRGLPDEGEDIDLANV 318
145223488 226 WLPLFHDMGLLMIMFPALAGGYLTLMSPVAFVRRPYRWIKEL--GADDRPMFAAAPNFAFALAAQRGLPPEGEELDLSNV 303
169628580 231 WLPLYHDMGLSMIGFPTVYGGHSTLMSPTAFIRRPQRWIKALSDGCTEGRVITAAPNFAYEYTAQRGVPKDGAGIDLGKA 310
118618331 321 V-LIIGSEPVSIDAVTTFNKVFAPYGLPRAAFKPSYGIAEATLLVATIDHAAEPTVVYLDREQLGAGHAVRVAAEAPNAV 399
108800833 319 V-LIVGSEPVSMAAIDTFTAAFAEYGLPPTAVKPSYGIAEATLFVATIAPDAEPSVAHFDRAQLAAGRAVRVAADAQDAV 397
120404573 304 AgLINGSEPVNISSVEKFNAAFAPYGLAPTVVKPSYGMAEATLFVSTTAPDARPEATYLDREKLTVGHAVRVDPGHPDAV 383
118472159 319 V-LIIGSEPVSPSAIADFNKAFAPYGLPATAFKPSYGIAEATLFVATIAPAAQASVVYFDRDELAQGRAVPVAGDAVDAV 397
119869973 319 V-LIVGSEPVSMAAIDTFTAAFAEYGLPPTAVKPSYGIAEATLFVATIAPDAEPSVAHFDRAQLAAGRAVRVAADAQDAV 397
118473450 301 AgLINGSEPVSMASINVFNEAFAPYGLPPTAVKPSYGMAEATLFVSTIGPAAHPSAVYLDREELGAGRAVEVPEDDPRAI 380
118467833 318 VtLLNGSEPVTMAAVEKFTTAFAPYGLPATAVKPSYGMAEATLSVASIAPSAAASVIHFDREELSAGRAVAVAHGTDRAV 397
126436431 319 V-LIIGSEPVSMAAIDTFTAAFAEYGLPPTAVKPSYGIAEATLFVATIAPDAEPSVAHFDRAQLAAGRAVRVAADAQDAV 397
145223488 304 AgLINGSEPISVAAVEAFNAAFAPYGLKQTVIKPSYGMAEATLFVSTTPPDSALKAVYVDRKQLTAGRAVIVDSDHPDAT 383
169628580 311 V-MIIGSEPVSIDAIRNFEKAFAPFGLPSTAFKPSYGIAEATLFIANIAPDAEPSVAYLDRTQLARGRAVPTDPDTPHVS 389
118618331 400 LQVSCGRVAHSLWAVIVDPDT--GTELRDGEVGEIWLQGNNVGRGYWGWPEDTERVFGAKLHSQLDEASHAAGAAVDGAW 477
108800833 398 AQVSCGQIARSQWAVIVDPDS--GEEMPDGYVGEIWLHGENLGRGYWGRPDETRETFCAAMTSR--AGGHADGVPDDGRW 473
120404573 384 AQVSCGTVSRSQWAAIVDPGT--ETEQPDGRVGEIWLHGDNIGRGYWGRPKETELTFQNKLQARLPAGSHAANCPENALW 461
118472159 398 AHVSCGQVARSLQAVIVDPGT--GEELGDGTVGEIWLHGNNIGRGYWNLPEQTRETFGATLRARLRDGTHSGNAPADARW 475
119869973 398 AQVSCGQIARSQWAVIVDPDS--GEEMPDGYVGEIWLHGENLGRGYWGRPDETRETFCAAMTSR--AGGHADGVPDDGRW 473
118473450 381 AQVSCGKIARSQWAVIVDPNSdtGAELPDGHVGEIWLYGDNVGKGYWGRPHETEVSFHNKLQSRLPQGSHAAGAPDGAAW 460
118467833 398 PHVSCGQPIPNQWAVIADAD---GNEAPDGAVGEIWLHGNNIGQGYFGRADETERVFGNKLQTRLDAGSHADGAPDNGAW 474
126436431 398 AQVSCGQIARSQWAVIVDPDS--GEEMPDGYVGEIWLHGENLGRGYWGRPDETRETFCAALTSR--AGGHADGVPDDGRW 473
145223488 384 VQVSCGNVARSQWAVIVDPAT--DCELPDGCVGEIWLHGDNIGNGYWERPEETELTFRNKLQSRLARGSHAERSADSALW 461
169628580 390 VHVSCGQLARSLHGVIVDPVG--TDELPDGHVGEIWLQGNNIGRGYWGRPEDTEKVFHARLGARQPKG-HAGEADIEGDW 466
118618331 478 LRTGDLGVYLDGELYVTGRIADLIVIDGHNHYPQDIEATVAEASPMVRRGYVTAFAAPANElptaqdsyshntSPQLVVI 557
108800833 474 LRTGDLGTYLDGELYVTGRLADLIVIDGRGHYPQDIEATTADASPLVRRGHATAFTVSGEQ---------------LVII 538
120404573 462 LRTGDLGVYLDGQLYITGRIKDLVIVDGRNHYPQDIEATAGEASTSVRSGFVAAFSVPGDG------------REEAVIV 529
118472159 476 LRTGDLGVYRDGELYVTGRIADLVVIDGRSHYPHDIETTVADASPLVRRGHVTAFTVAAQDvpgas---dgqtQDGLVVI 552
119869973 474 LRTGDLGTYLDGELYVTGRLADLIVIDGRGHYPQDIEATTADASPLVRRGHATAFTVSGEQ---------------LVII 538
118473450 461 FRTGDLGMYLGGELYITGRIKDMVIVDGRNHYPQDLEATVAEASSQVRAGYIAAFSVPSEH------------GERLVIV 528
118467833 475 LATGDLGVYVDGELYLTGRIKDLIVIDGRNHYPTDIETTVSLSSPAVRSGYVAAFSIPGER------------GEELAIV 542
126436431 474 LRTGDLGTYLDGELYVTGRLADLIVIDGRGHYPQDIEATTADASPLVRRGHATAFTVSGEQ---------------LVII 538
145223488 462 LRTGDLGVYLDGELYITGRIKDLIIVDGRNHYPQDIEATAAAASPSVRAGFVAAFSVPGEG------------REEVVIV 529
169628580 467 LRTGDMGFYLDGELYVTGRLADHIEVDGSSHYPQDIEASVAAASPIVRRGYVTAFTVPGGG---------------LVIV 531
118618331 558 AERAAGSSRDDPQPAIQAIRAAVANRHGLAVAEVRFLPAGAIPRTTSGKLARRACRGQYLGGVLGVH 624
108800833 539 AERASGTRRADPAPAVEAIRAAVRQRHGIEVADVRFVPAGAIPRTTSGKLARRACRTEYIDGTLRAN 605
120404573 530 AERAPGAGRAEAAPIQESIRAAVSRRHALPVKDVKLVAAGVIPRTTSGKLARQACRAAYLNGEL--- 593
118472159 553 AERAVGTTRADPQPGIDAIRAAVAHRHGVTVADVRFVPAGAIPRTTSGKLARRACRAQYLEGKLGAH 619
119869973 539 AERASGTRRADPAPAVEAIRAAVRQRHGIEVADVRFVPAGAIPRTTSGKLARRACRTEYIDGTLRAN 605
118473450 529 AERAPGAGRADPAPIVDAIRAAISKRHAVAVHDIKLVAAGSIPRTTSGKLARRACQAQYLAELQTS- 594
118467833 543 AERAAGAGRAEPGPIVDAVRAAVSRQHQVRVADVRMVAAGVIPRTTSGKLARSACRAEYLAGKYDPV 609
126436431 539 AERASGTRRADPAPAVEAIRAAVRQRHGVEVADVRFVPAGAIPRTTSGKLARRACRAEYVDGTLRAN 605
145223488 530 AERAPGAGRAEAAPIQEAIRAEVSRKHAIPVRDVKLVRSGVIPRTTSGKLARRSCRASYLDGTL--- 593
169628580 532 AERASRTAKADPQEAIDAISAAVDAEYGLKPADVLLLSAGAIPRTTSGKLARRACRRHYLEGTLGVH 598
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap