Conserved Protein Domain Family
PRK12474

?
PRK12474: PRK12474 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 139002
View PSSM: PRK12474
Aligned: 9 rows
Threshold Bit Score: 857.249
Threshold Setting Gi: 90424980
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
39935395   10 AVQSMTGADRLCDALLAHEVDVCFANPGTSEMHFVAALDRQPRMRCILGLFEGVVTGAADGYARMTDRPAVTLLHLGPGL 89 
86750245   10 AMQSMTGADRLCDALLAHEVDVCFANPGTSEMHFVAALDRQPRMRCILGLFEGVVTGAADGYARMRDRPAATLLHLGPGL 89 
39935070    1 ----MNGAQSVVRTLVNCGVEVCFANPGTSEMHFVAALDSVSGMRPVLCLFEGVVTGAADGYGRIAGKPAVNLLHLGPGL 76 
91976547    1 MGDTINGAQSVVQTLINCGVEVCFANPGTSEMHFVAALDTVSGMRPVLCLFEGVVTGAADGYGRIAGKPAVTLLHLGPGL 80 
90423593    1 MGHAMNGAHSVVQTLVNCGVEVCFANPGTSEMHFVAALDAVGGMRPVLCLFEGVATGAADGYGRIAGKPAATLLHLGPGL 80 
90424980   11 SAQTMTGADRLCDALLAHEVDVCFANPGTSEMHFVAALDRQPRMKCILGLFEGVVTGAADGYARMRDRPAVTLLHLGPGL 90 
115524017   1 MGPTINGAQSVVQTLVNCGVEVCFGNPGTSEMHFVAALDSVSAMRPVLCLFEGVATAAADGYGRIAGKPAATLLHLGPGL 80 
192290603   1 MGEGMNGAQSVVRTLVNCGVEVCFANPGTSEMHFVAALDSVSGMRPVLCLFEGVVTGAADGYGRIAGKPAVNLLHLGPGL 80 
192290953  10 AVQSMTGADRLCDALLAHEVDVCFANPGTSEMHFVAALDRQPRMRCILGLFEGVVTGAADGYARMTDRPAVTLLHLGPGL 89 
39935395   90 ANGLANMHNARRAHSPMINIVGDHAVEHLPLDAPLTSDIDSLARPMSRWVKRIADPVRIDQDVADAW--SQSMAPGISTL 167
86750245   90 ANGLANIHNARRAHSPMINVVGDHAVEHLPLDSPLTSDIDSLARPMSRWVKRIGDPTRIDLDVAEAW--SQSMAPGISTL 167
39935070   77 ANGLANLHNARRAATPIVNIVGDHAAYHLQYDAPLTSDIAGFARPVSSWIHESKSAGAVASDTARAVqaASAAPGGIATL 156
91976547   81 ANGLANLHNARRAATPIVNIVGDHAAHHLQYDAPLTSDIVGFARPVSNWIVESKSAGAVASDVARAVqaAKAAPGAIATL 160
90423593   81 ANGLANLHNARRAASPIVNVVGDHATYHLQYDALLTSDIAGFARPVSSWIHQSTSAGSVGADATRAVqaARSAPGGIATL 160
90424980   91 ANGLANIHNARRANSPMINIVGDHAVEHLPLDSPLTSDIDSLARPMSRWVRRIADPVQIDSDVAEAW--SQSLTPGISTL 168
115524017  81 ANGLANLHNARRAASPIVNIVGDHASYHAQYDAPLASDIAGFAWPVSSWVHESRSAGAVASDTARAVqaARSAPGGIATL 160
192290603  81 ANGLANLHNARRAATPIVNIVGDHAAYHLQYDAPLTSDIAGFARPVSSWIHESKSAGAVASDTARAVqaACAAPGGIATL 160
192290953  90 ANGLANMHNARRAHSPMINIVGDHAVEHLPLDAPLTSDIDSLARPMSRWVKRIADPVRIDQDVADAW--SQSMAPGISTL 167
39935395  168 ILPADMAWNEHSYRSAPVRGkrLPQTPLVQEMVVRIGAAIRTKRKVVLMLSGGALREHPLRIADNIRRSAGVEIYAQGAN 247
86750245  168 ILPADMAWNEHVYRAPPARGrrLPQAPLQQETVARIGAAIRTKRRVVLLLTGAALREQALSIADGIRRSAGVEIYAQGAN 247
39935070  157 IMPADVAWNPAARAAQKLPE--IGPAKVAAETVEAIAKLLANGKKSALLLRGSALLGDVLEAAGRVAAKTGVRLLCDTFA 234
91976547  161 IMPADVAWNAAARAAQPLVD--YGPARVHADTIEAVAKLLSNGKKSALLLRGNALLGSGLEAAGRIQAKCGARLMCDTFA 238
90423593  161 IMPADVAWNEAALAAHKLDD--IGPSRVAADSIEAVAALLGNGKKSALLIRGDGLRGAGLEAAGRIQAKTGARLLCDTFA 238
90424980  169 ILPADMAWNEHRYTAALARGqrPQREPLNPDSITRIGAALRGKRKVALLLTGAALRDAPLQLAARISSATGAEIFAQGAN 248
115524017 161 IMPADVAWNEAGGAASKLAD--IGPARVGVETIAQVAALLSNGKKSALLMRGSALFGNGLEAAGRVQAKTGVRLMCDTFA 238
192290603 161 IMPADVAWNPAARAAQKLPE--IGPAKVAAETVEAIAKLLANGKKSALLLRGSALLGDALEAAGRVAAKTGVRLLCDTFA 238
192290953 168 ILPADMAWNEHSYRSQPVRGkrLPQTPLVQEMVVRIGAAIRTKRKVVLMLSGGALREHPLRIADNIRRSAGVEIYAQGAN 247
39935395  248 GRIERGRGRAPIAKLPMTHEIGIEMLRGADMVVLIGAKEPVSFFAYPNRPGRLAPPNCEIVQLAGPDQDLVQALEWLADE 327
86750245  248 GRIERGRGRAPIAKLAMTHEIGGRMLQDVDMVVLIGAKEPVSFFAYPNRPGRLAPANCEIVRLAGPDQDLVQALEWLADE 327
39935070  235 PQTELGAGRVPLERIPYFSEQITAFLKDVEQLILVGAKPPVSFFAYPGKPSWGAPEGCLIDYLAQPHEDGAQAVRDLAAA 314
91976547  239 PQTELGAGRVPLERIPYFSEQITAFLKDVEQLVLVGAKPPVSFFAYPGKPSWGAPDGCQFEYLAQPHEDGAQALRDLATA 318
90423593  239 PHGEFGAGRVPVERIPYFAEQIVMFLKDVEQLILVGAKPPVSFFAYPGKPSWGAAEGCVFSYLAQPTEDCARALQDLADA 318
90424980  249 GRIERGRGRTPIAKLQLTHEVGGRMLRDVEMLVLIGSQEPVSFFAYPNQPGRLAQPSCEIVQLARADQDLVQALQWLADE 328
115524017 239 PHSELGAGRVPVERIPYFAEQIVGFLKDVEQLILVGAKPPVSFFAYPGKPSWGSPEGCAFIYLAQPHEEGALALQDLADA 318
192290603 239 PQTELGAGRVPLERIPYFSEQITAFLKDVEQLILVGAKPPVSFFAYPGKPSWGAPDGCLIDYLAQPHEDGAQAVKDLAAA 318
192290953 248 GRIERGRGRAPIAKLPMTHEIGIEMLRGADMVVLIGAKEPVSFFAYPNRPGRLAPPNCEIVQLAGPDQDLVQALEWLADE 327
39935395  328 VNAPNEPVAVAPFAVPAPtagPNAALTVDMVNRLVAARLPDQAIVCDEALTSSGFFDYSYD-AAPHDYLQITGGAIGIGI 406
86750245  328 VDAPRAPVAVAPRAAAAPv--ASGALTVDMVNRLVAARLPEQAIVCDEALTSSGFFDLSYD-APPHDYLQITGGAIGIGI 404
39935070  315 LDAPAEPAARTQLVLPEL---PKGKLNSLGVAQAIAHLTPDHAIYAEEANTSGLPFQMILPkARPHTHLPLTGGSIGQGL 391
91976547  319 LDAPAEPKTRTQLALPDL---PKGKLNSLGVAQVIAHHTPDHAIYAEEAATSGLPFQMIVPrARPHTHLPLTGGSIGQGL 395
90423593  319 LDAPAEPATRTPLVLPEL---PKGKLNSLGVAQVIAHYTPDNAIYADESATSGLALMIHLArARPYTHLPLAGGSIGQGL 395
90424980  329 VKAPASPLALPAPTAAAPv-gPGDALTIAAVNRLVADRLPEQAIVCDEALTSSGFYDCSYE-SEPHDYLQITGGAIGIGI 406
115524017 319 LDAPAQPAIRIPLVLPDL---PKGRLNSVSAAQIIAHYTPDNAIYAEEATTSGLPLMMQLArGRPMTHLPLTGGSIGQGL 395
192290603 319 VDAPAEPAARTQLVLPEL---PKGKLNSLGVAQAIAHLTPDHAIYAEEANTSGLPFQMILPkARPHTHLPLTGGSIGQGL 395
192290953 328 VNAPNEPVAVAPFAVPAPtvgPNAALTVDMVNRLVAARLPDQAIVCDEALTSSGFFDYSYD-AAPHDYLQITGGAIGIGI 406
39935395  407 PMAAGAAVACPGRKVINLQADGSGMYTLQGLWTHARENLDVVTIVFSNRSYATLWGEMSKVGAQTPGRNAQRMLQLDQPE 486
86750245  405 PMAAGAAVACPDRKVINLQADGSGMYTVQGLWTHARENLDVLTIVFSNRSYATLWGEMSKVGAQTPGRNAQRMLQLDQPE 484
39935070  392 PLAIGAAIAAPDRKVVCPHGDGGAAYTMQALWTMAREKLDVTVVIYANRSYAILNIELQRVGASGAGANALSMLDLHNPE 471
91976547  396 PLAIGAAIAAPDRKVVCPHGDGGAAYTMQALWTMAREQLDITVVIYANRSYAILNVELQRVGASGAGSKALSMLDLHNPE 475
90423593  396 PLAVGAALAAPDRKVVCPSGDGGAAYTLQALWTMARENLDVTVVIFANHSYAILNIELQRVGVGSAGAKALSMLDLHNPE 475
90424980  407 PMAAGAAVACPNRKVINLQADGSGMYTVQGLWTHARENLDVLTIVFSNRSYATLWGEMHKVGAQVPGRNAERMLRLDQPD 486
115524017 396 PLAIGAAIAAPDRKVVCPHGDGGAAYTMQALWTMARENLDVTVVIYANRSYAILNIELQRVGASGAGPKALSMLDLHNPE 475
192290603 396 PLAIGAAIAAPDRKVVCPHGDGGAAYTMQALWTMAREKLDVTVVIYANRSYAILNIELQRVGASGAGANALSMLDLHNPE 475
192290953 407 PMAAGAAVACPARKVINLQADGSGMYTLQGLWTHARENLDVVTIVFSNRSYATLWGEMSKVGAQTPGRNAQRMLQLDQPE 486
39935395  487 LDWSKMSQGLGVEAGRATTLSEFSRALDAALARRGPYLIEAMV 529
86750245  485 LDWTKLAAGLGVESRRVTTASEFSRAFDAALGRRGPAVIEAMV 527
39935070  472 MNWMKIAEGLGVEASRATTAEEFSAQYASAMSQRGPRLIEALI 514
91976547  476 MNWMKIAEGLGVEASRATTAEEFAAQYASAMSQRGPRLIEALI 518
90423593  476 INWVQIASGLGVAASRATTAEEFTAQYADAMAQRGPRLIEAMI 518
90424980  487 LDWAKLAEGMGVEASRAATVTAFSKALDAALSRRGPCLIEAIV 529
115524017 476 INWAQIASGLGVEASRATTAEEFAAQYASAMAQRGPRLIEAMI 518
192290603 476 MNWMKIAEGLGVEASRATTAEEFSAQYASAMSQRGPRLIEALI 518
192290953 487 LDWSKMSQGLGVEASRATTLSEFSRALDAALARRGPYLIEAMV 529
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap