Conserved Protein Domain Family
PRK12470

?
PRK12470: PRK12470 
amidase; Provisional
Statistics
?
PSSM-Id: 171524
View PSSM: PRK12470
Aligned: 14 rows
Threshold Bit Score: 658.111
Threshold Setting Gi: 226307354
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
226307354   7 TPGSELAFAGVAGQAALIRSGEISARELTENTLRRIERLDSTLNAFVRVLADEGLDEATRLDQRQADGHSLgPLHGVPIA 86 
41408607    1 --MNDLAFAGAAAQARMLANGDLSAPELLEVYLERIARLDSQLRCYRVVLADRARREAAAAQSRLDAGERL-PLLGVPVA 77 
15608403    1 MDPTDLAFAGAAAQARMLADGALTAPMLLEVYLQRIERLDSHLRAYRVVQFDRARAEAEAAQQRLDAGERL-PLLGVPIA 79 
118463408   1 --MNDLAFAGAAAQARMLANGDLSAPELLEVYLERIARLDSQLRCYRVVLADRARREAAAAQSRLDAGERL-PLLGVPVA 77 
118619588   1 MDPSDLAFAGAAAQARMLADGEVTAPMLLEVYLERIERLDSELRAYRVVRYDAAREEAEVAQQRLDAGERL-PLLGVPIA 79 
121637191   1 MDPTDLAFAGAAAQARMLADGALTAPMLLEVYLQRIERLDSHLRAYRVVQFDRARAEAEAAQQRLDAGERL-PLLGVPIA 79 
148822480   1 MDPTDLAFAGAAAQARMLADGALTAPMLLEVYLQRIERLDSHLRAYRVVQFDRARAEAEAAQQRLDAGERL-PLLGVPIA 79 
148661050   1 MDPTDLAFAGAAAQARMLADGALTAPMLLEVYLQRIERLDSHLRAYRVVQFDRARAEAEAAQQRLDAGERL-PLLGVPIA 79 
183984147   1 MDPSDLAFAGAAAQARMLADGEVTAPMLLEVYLERIERLDSELRAYRVVRYDAAREEAEVAQQRLDAGERL-PLLGVPIA 79 
224989666   1 MDPTDLAFAGAAAQARMLADGALTAPMLLEVYLQRIERLDSHLRAYRVVQFDRARAEAEAAQQRLDAGERL-PLLGVPIA 79 
226307354  87 IKDENDVAGTPTTYGGAAATRIASADSEVVRRLREAGAVIVGKTTMPEFGIWPFTETAANGYTRNPWDTGISTGGSSGGS 166
41408607   78 IKDDVDVAGEVTTFGSGGHGPAVSSDAEVVRRLRAAGAVIIGKTNVPELMMMPYTESLTFGATRNPWDPRRTPGGSSGGS 157
15608403   80 IKDDVDIAGEVTTYGSAGHGPAATSDAEVVRRLRAAGAVIIGKTNVPELMIMPFTESLAFGATRNPWCLNRTPGGSSGGS 159
118463408  78 IKDDVDVAGEVTTFGSGGHGPAVSSDAEVVRRLRAAGAVIIGKTNVPELMMMPYTESLTFGATRNPWDPRRTPGGSSGGS 157
118619588  80 IKDDVDVAGEVTTYGSGGHGAPAGSDAEMVRRLRAAGAVIIGKTNVPELMMMPYTESLTFGATRNPWNPARTPGRSSGGS 159
121637191  80 IKDDVDIAGEVTTYGSAGHGPAATSDAEVVRRLRAAGAVIIGKTNVPELMIMPFTESLAFGATRNPWCLNRTPGGSSGGS 159
148822480  80 IKDDVDIAGEVTTYGSAGHGPAATSDAEVVRRLRAAGAVIIGKTNVPELMIMPFTESLAFGATRNPWCLNRTPGGSSGGS 159
148661050  80 IKDDVDIAGEVTTYGSAGHGPAATSDAEVVRRLRAAGAVIIGKTNVPELMIMPFTESLAFGATRNPWCLNRTPGGSSGGS 159
183984147  80 IKDDVDVAGEVTTYGSGGHGAPAGSDAEMVRRLRAAGAVIIGKTNVPELMMMPYTESLTFGATRNPWNPARTPGGSSGGS 159
224989666  80 IKDDVDIAGEVTTYGSAGHGPAATSDAEVVRRLRAAGAVIIGKTNVPELMIMPFTESLAFGATRNPWCLNRTPGGSSGGS 159
226307354 167 ASAVASGMVAAAIGGDGGGSIRLPSAFCGLFGLKPQRGRVSTAPNRNLWRGLGTLGPLTRSVEDSALVYDVITgttgidd 246
41408607  158 AAAVAAGLAPLALGSDGGGSIRIPSTWCGLFGLKPQRDRVSLEPHDDAWYGLSVNGPIARTVIDAAVFLDATS------- 230
15608403  160 AAAVAAGLAPVALGSDGGGSIRIPCTWCGLFGLKPQRDRISLEPHDGAWQGLSVNGPIARSVMDAALLLDATT------- 232
118463408 158 AAAVAAGLAPLALGSDGGGSIRIPSTWCGLFGLKPQRDRVSLEPHDDAWYGLSVNGPIARTVIDAAVFLDATS------- 230
118619588 160 AAAVAAGLAPVAFGSDGGGSIRIPSTWCGVFGLKTQRDRISLEPHDGAWYGLSVNGPIARSVLDTALLLDATT------- 232
121637191 160 AAAVAAGLAPVALGSDGGGSIRIPCTWCGLFGLKPQRDRISLEPHDGAWQGLSVNGPIARSVMDAALLLDATT------- 232
148822480 160 AAAVAAGLAPVALGSDGGGSIRIPCTWCGLFGLKPQRDRISLEPHDGAWQGLSVNGPIARSVMDAALLLDATT------- 232
148661050 160 AAAVAAGLAPVALGSDGGGSIRIPCTWCGLFGLKPQRDRISLEPHDGAWQGLSVNGPIARSVMDAALLLDATT------- 232
183984147 160 AAAVAAGLAPVAFGSDGGGSIRIPSTWCGVFGLKTQRDRISLEPHDGAWYGLSVNGPIARSVLDAALLLDATT------- 232
224989666 160 AAAVAAGLAPVALGSDGGGSIRIPCTWCGLFGLKPQRDRISLEPHDGAWQGLSVNGPIARSVMDAALLLDATT------- 232
226307354 247 yTAETLRASFAESAASAPGPLRIAVSTRSPV-RGVRPSPEVVAAVHSIAEMLSALGHHVEEHDPEYPDATAA--FLPQVL 323
41408607  231 -TVPGPEGEFVAAATREPGRLRIALSTKVPTpLPVRVGKPELAAVQQAGALLRDLGHDVVTADPEYPAAAILgnYLPRYL 309
15608403  233 -TVPGPEGEFVAAAARQPGRLRIALSTRVPTpLPVRCGKQELAAVHQAGALLRDLGHDVVVRDPDYPASTYAn-YLPRFF 310
118463408 231 -TVPGPEGEFVAAATREPGRLRIALSTKVPTpLPVRVGKPELAAVQQAGALLRDLGHDVVTADPEYPAAAILgnYLPRYL 309
118619588 233 -TVPGPDAEFADAAQREPGRLRIALSTKIPTpLPVRVGQAEVAAVYRAGGLLRELGHEVINRDPDYPAALYAn-YLPRYL 310
121637191 233 -TVPGPEGEFVAAAARQPGRLRIALSTRVPTpLPVRCGKQELAAVHQAGALLRDLGHDVVVRDPDYPASTYAn-YLPRFF 310
148822480 233 -TVPGPEGEFVAAAARQPGRLRIALSTRVPTpLPVRCGKQELAAVHQAGALLRDLGHDVVVRDPDYPASTYAn-YLPRFF 310
148661050 233 -TVPGPEGEFVAAAARQPGRLRIALSTRVPTpLPVRCGKQELAAVHQAGALLRDLGHDVVVRDPDYPASTYAn-YLPRFF 310
183984147 233 -TVPGPDAEFADAAQREPGRLRIALSTKIPTpLPVRVGQAEVAAVYRAGGLLRELGHEVINRDPDYPAALYAd-YLPRYL 310
224989666 233 -TVPGPEGEFVAAAARQPGRLRIALSTRVPTpLPVRCGKQELAAVHQAGALLRDLGHDVVVRDPDYPASTYAn-YLPRFF 310
226307354 324 GGVRDEALRVDHPALLEKRTRALASIGRVAAPARVGkfAYRKGE-RIAATVNQVFDTFDLVLMPTTPALPRPIGQLEGTG 402
41408607  310 RGICDDADSLAHPERLETRTRNMARMGSFFSDRRMA--AIRAGEgPLIARIQAIFDDVDVVVTPGTAAGPSRVGAYQRRG 387
15608403  311 RGISDDADAQAHPDRLEARTRAIARLGSFFSDRRMA--ALRAAEvVLSSRIQSIFDDVDVVVTPGAATGPSRIGAYQRRG 388
118463408 310 RGICDDADSLAHPERLEARTRNMARMGSFFSDRRMA--AIRAGEgPLIARIQAIFDDVDVVVTPGTAAGPSRVGAYQRRG 387
118619588 311 RGISDDADALAHPHRLEERTRAIARMGSFFSDRRMA--GLRAAEaALNKRIQSIFDDVDVVITPGTANGPSRIGAYQRRG 388
121637191 311 RGISDDADAQAHPDRLEARTRAIARLGSFFSDRRMA--ALRAAEvVLSSRIQSIFDDVDVVVTPGAATGPSRIGAYQRRG 388
148822480 311 RGISDDADAQAHPDRLEARTRAIARLGSFFSDRRMA--ALRAAEvVLSSRIQSIFDDVDVVVTPGAATGPSRIGAYQRRG 388
148661050 311 RGISDDADAQAHPDRLEARTRAIARLGSFFSDRRMA--ALRAAEvVLSSRIQSIFDDVDVVVTPGAATGPSRIGAYQRRG 388
183984147 311 RGISDDADALAHPHRLEARTRAIARMGSFFSDRRMA--ALRAAEaALNKRIQSIFDDVDVVITPGTANGPSRIGAYQRRG 388
224989666 311 RGISDDADAQAHPDRLEARTRAIARLGSFFSDRRMA--ALRAAEvVLSSRIQSIFDDVDVVVTPGAATGPSRIGAYQRRG 388
226307354 403 LLSAVRKALPIAAYCSIWNVCGNPAAAVPAGFSERGLPLSVQLVGRSGGEPTILAVAQQLESTVRWPDSHPPHS 476
41408607  388 AVSTLLRVGQCVPYQQIWNLTGQPAAVVPWDFDADGLPMSVQLVGRPYDEATLLSLSAQIEAARPWALRRPPVC 461
15608403  389 AVSTLLLVVQRVPYFQVWNLTGQPAAVVPWDFDGDGLPMSVQLVGRPYDEATLLALAAQIESARPWAHRRPSVS 462
118463408 388 AVSTLLRVGQCVPYQQIWNLTGQPAAVVPWDFDADGLPMSVQLVGRPYDEATLLSLSAQIEAARPWALRRPPVC 461
118619588 389 AVSTLLLVAQRVPYLQVWNLTCQAAAVVPWDFDDDGMPISIQLVGKPYDEATLLSLSAQIEAARPWADRRPPVS 462
121637191 389 AVSTLLLVVQRVPYFQVWNLTGQPAAVVPWDFDGDGLPMSVQLVGRPYDEATLLALAAQIESARPWAHRRPSVS 462
148822480 389 AVSTLLLVVQRVPYFQVWNLTGQPAAVVPWDFDGDGLPMSVQLVGRPYDEATLLALAAQIESARPWAHRRPSVS 462
148661050 389 AVSTLLLVVQRVPYFQVWNLTGQPAAVVPWDFDGDGLPMSVQLVGRPYDEATLLALAAQIESARPWAHRRPSVS 462
183984147 389 AVSTLLLVAQRVPYLQVWNLTGQPAAVVPWDFDDDGMPISIQLVGKPYDEVTLLSLSAQIEAARPWADRRPPVS 462
224989666 389 AVSTLLLVVQRVPYFQVWNLTGQPAAVVPWDFDGDGLPMSVQLVGRPYDEATLLALAAQIESARPWAHRRPSVS 462
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap