Conserved Protein Domain Family
flhB

?
PRK12468: flhB 
flagellar biosynthesis protein FlhB; Reviewed
Statistics
?
PSSM-Id: 171522
View PSSM: PRK12468
Aligned: 13 rows
Threshold Bit Score: 751.478
Threshold Setting Gi: 157371217
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
45441419    1 MAEDSDQEKSEEPTASKLEKAREKGQIPRSRELTSMLMLGAGLTILWMSGESMARQLSAMVAQGLHFDHSMVSNDKQMLR 80 
108812495   1 MAEDSDQEKSEEPTASKLEKAREKGQIPRSRELTSMLMLGAGLTILWMSGESMARQLSAMVAQGLHFDHSMVSNDKQMLR 80 
22126401    1 MAEDSDQEKSEEPTASKLEKAREKGQIPRSRELTSMLMLGAGLTILWMSGESMARQLSAMVAQGLHFDHSMVSNDKQMLR 80 
108807160   1 MAEDSDQEKSEEPTASKLEKAREKGQIPRSRELTSMLMLGAGLTILWMSGESMARQLSAMVAQGLHFDHSMVSNDKQMLR 80 
51596001    1 MAEDSDQEKSEEPTASKLEKAREKGQIPRSRELTSMLMLGAGLTILWMSGESMARQLSAMVAQGLHFDHSMVSNDKQMLR 80 
145598622   1 MAEDSDQEKSEEPTASKLEKAREKGQIPRSRELTSMLMLGAGLTILWMSGESMARQLSAMVAQGLHFDHSMVSNDKQMLR 80 
123442794   1 MAEDSDADKSEEPTAHKLEKAREKGQIPRSRELTSMLMLGAGLAILWVSGESMARQLAAMIAQGLHFDHGLISDDKQMLR 80 
153947600   1 MAEDSDQEKSEEPTASKLEKAREKGQIPRSRELTSMLMLGAGLTILWMSGESMARQLSAMVAQGLHFDHSMVSNDKQMLR 80 
157371217  16 VAEDSDLEKSEAPTPHRVEKAREDGQIPRSRELTSVLMLVAGLSIIWVAGSNMSQQLAMMLTQGLNFDHSMVSNDKQMLR 95 
170024657   1 MAEDSDQEKSEEPTASKLEKAREKGQIPRSRELTSMLMLGAGLTILWMSGESMARQLSAMVAQGLHFDHSMVSNDKQMLR 80 
186895104   1 MAEDSDQEKSEEPTASKLEKAREKGQIPRSRELTSMLMLGAGLTILWMSGESMARQLSAMVAQGLHFDHSMVSNDKQMLR 80 
218928912   1 MAEDSDQEKSEEPTASKLEKAREKGQIPRSRELTSMLMLGAGLTILWMSGESMARQLSAMVAQGLHFDHSMVSNDKQMLR 80 
294504041   1 MAEDSDQEKSEEPTASKLEKAREKGQIPRSRELTSMLMLGAGLTILWMSGESMARQLSAMVAQGLHFDHSMVSNDKQMLR 80 
45441419   81 QIGMLLRQTLLAMLPIFAGLVIVALAVPMLLGGVLFSGESIKFDLKRMSPVAGLKRMFSSQALAELLKAILKATLVGWVT 160
108812495  81 QIGMLLRQTLLAMLPIFAGLVIVALAVPMLLGGVLFSGESIKFDLKRMSPVAGLKRMFSSQALAELLKAILKATLVGWVT 160
22126401   81 QIGMLLRQTLLAMLPIFAGLVIVALAVPMLLGGVLFSGESIKFDLKRMSPVAGLKRMFSSQALAELLKAILKATLVGWVT 160
108807160  81 QIGMLLRQTLLAMLPIFAGLVIVALAVPMLLGGVLFSGESIKFDLKRMSPVAGLKRMFSSQALAELLKAILKATLVGWVT 160
51596001   81 QIGMLLRQTLLAMLPIFAGLVIVALAVPMLLGGVLFSGESIKFDLKRMSPVAGLKRMFSSQALAELLKAILKATLVGWVT 160
145598622  81 QIGMLLRQTLLAMLPIFAGLVIVALAVPMLLGGVLFSGESIKFDLKRMSPVAGLKRMFSSQALAELLKAILKATLVGWVT 160
123442794  81 QIGMLLRQTLIALIPIFAGLVIVAMAVPMLLGGVLFSGESIKFDLKRMSPIAGLKRMFSSQALAELLKAILKATLVGWVT 160
153947600  81 QIGMLLRQTLLAMLPIFAGLVIVALAVPMLLGGVLFSGESIKFDLKRMSPIAGLKRMFSSQALAELLKAILKATLVGWVT 160
157371217  96 QLGMLLRQAVWALLPVMAGLTLVAITAPMLLGGLLLSGKSLKFDLKRMNPLTGLKRIFSSQVLAELLKGILKATLVGWVT 175
170024657  81 QIGMLLRQTLLAMLPIFAGLVIVALAVPMLLGGVLFSGESIKFDLKRMSPVAGLKRMFSSQALAELLKAILKATLVGWVT 160
186895104  81 QIGMLLRQTLLAMLPIFAGLVIVALAVPMLLGGVLFSGESIKFDLKRMSPVAGLKRMFSSQALAELLKAILKATLVGWVT 160
218928912  81 QIGMLLRQTLLAMLPIFAGLVIVALAVPMLLGGVLFSGESIKFDLKRMSPVAGLKRMFSSQALAELLKAILKATLVGWVT 160
294504041  81 QIGMLLRQTLLAMLPIFAGLVIVALAVPMLLGGVLFSGESIKFDLKRMSPVAGLKRMFSSQALAELLKAILKATLVGWVT 160
45441419  161 GLFLWHNWPDMMRLIAAPPVAALGDALHLIIFCGLVVVLGLSPMVGFDVFYQITSHIKKLRMTKQDIRDEFKNQEGDPHV 240
108812495 161 GLFLWHNWPDMMRLIAAPPVAALGDALHLIIFCGLVVVLGLSPMVGFDVFYQITSHIKKLRMTKQDIRDEFKNQEGDPHV 240
22126401  161 GLFLWHNWPDMMRLIAAPPVAALGDALHLIIFCGLVVVLGLSPMVGFDVFYQITSHIKKLRMTKQDIRDEFKNQEGDPHV 240
108807160 161 GLFLWHNWPDMMRLIAAPPVAALGDALHLIIFCGLVVVLGLSPMVGFDVFYQITSHIKKLRMTKQDIRDEFKNQEGDPHV 240
51596001  161 GLFLWHNWPDMMRLIAAPPVAALGDALHLIIFCGLVVVLGLSPMVGFDVFYQITSHIKKLRMTKQDIRDEFKNQEGDPHV 240
145598622 161 GLFLWHNWPDMMRLIAAPPVAALGDALHLIIFCGLVVVLGLSPMVGFDVFYQITSHIKKLRMTKQDIRDEFKNQEGDPHV 240
123442794 161 GIFLWHNWPDMMRLMAAPPVAALGDALHLIIFCGLVVVLGLTPMVGFDVFFQITSHIKKLRMTKQEIRDEFKDQEGDPHV 240
153947600 161 GLFLWHNWPDMMRLIAAPPVAALGDALHLIIFCGLVVVLGLLPMVGFDVFYQITSHIKKLRMTKQDIRDEFKNQEGDPHV 240
157371217 176 GLYLWHNWAAMLHLVTQQPLDALANALQMIIFCGLLVVLALTPMVAFDVFYQLWSHFKKLKMTKQDIRDEFKDQEGDPHV 255
170024657 161 GLFLWHNWPDMMRLIAAPPVAALGDALHLIIFCGLVVVLGLSPMVGFDVFYQITSHIKKLRMTKQDIRDEFKNQEGDPHV 240
186895104 161 GLFLWHNWPDMMRLIAAPPVAALGDALHLIIFCGLVVVLGLSPMVGFDVFYQITSHIKKLRMTKQDIRDEFKNQEGDPHV 240
218928912 161 GLFLWHNWPDMMRLIAAPPVAALGDALHLIIFCGLVVVLGLSPMVGFDVFYQITSHIKKLRMTKQDIRDEFKNQEGDPHV 240
294504041 161 GLFLWHNWPDMMRLIAAPPVAALGDALHLIIFCGLVVVLGLSPMVGFDVFYQITSHIKKLRMTKQDIRDEFKNQEGDPHV 240
45441419  241 KGRIRQQQRAMARRRMMVDVPKADVIVTNPTHYAVALQYNESKMSAPKVLAKGAGAVALRIRELGAEHRIPLLEAPPLAR 320
108812495 241 KGRIRQQQRAMARRRMMVDVPKADVIVTNPTHYAVALQYNESKMSAPKVLAKGAGAVALRIRELGAEHRIPLLEAPPLAR 320
22126401  241 KGRIRQQQRAMARRRMMVDVPKADVIVTNPTHYAVALQYNESKMSAPKVLAKGAGAVALRIRELGAEHRIPLLEAPPLAR 320
108807160 241 KGRIRQQQRAMARRRMMVDVPKADVIVTNPTHYAVALQYNESKMSAPKVLAKGAGAVALRIRELGAEHRIPLLEAPPLAR 320
51596001  241 KGRIRQQQRAMARRRMMVDVPKADIIVTNPTHYAVALQYNESKMSAPKVLAKGAGAVALRIRELGAEHRIPLLEAPPLAR 320
145598622 241 KGRIRQQQRAMARRRMMVDVPKADVIVTNPTHYAVALQYNESKMSAPKVLAKGAGAVALRIRELGAEHRIPLLEAPPLAR 320
123442794 241 KGRIRQQQRAMARRRMMADVHKADVIVTNPTHYAVALQYNETKMSAPKVLAKGAGAVALRIRELGAEHRIPLLEAPPLAR 320
153947600 241 KGRIRQQQRAMARRRMMVDVPKADVIVTNPTHYAVALQYNESKMSAPKVLAKGAGAVALRIRELGAEHRIPLLEAPPLAR 320
157371217 256 KGRIRQQQRAIARRRMMADVPKADVIVTNPTHYAVALQYNDKKMSAPKVLAKGAGEIALRIRELGMQHRIPMLEAPPLAR 335
170024657 241 KGRIRQQQRAMARRRMMVDVPKADVIVTNPTHYAVALQYNESKMSAPKVLAKGAGAVALRIRELGAEHRIPLLEAPPLAR 320
186895104 241 KGRIRQQQRAMARRRMMVDVPKADVIVTNPTHYAVALQYNESKMSAPKVLAKGAGAVALRIRELGAEHRIPLLEAPPLAR 320
218928912 241 KGRIRQQQRAMARRRMMVDVPKADVIVTNPTHYAVALQYNESKMSAPKVLAKGAGAVALRIRELGAEHRIPLLEAPPLAR 320
294504041 241 KGRIRQQQRAMARRRMMVDVPKADVIVTNPTHYAVALQYNESKMSAPKVLAKGAGAVALRIRELGAEHRIPLLEAPPLAR 320
45441419  321 ALFRHSEVGQHIPATLYAAVAEVLAWVYQLKRWKREGGLIPKKPEHLPVPEALDFATESETKSETD 386
108812495 321 ALFRHSEVGQHIPATLYAAVAEVLAWVYQLKRWKREGGLIPKKPEHLPVPEALDFATESETKSETD 386
22126401  321 ALFRHSEVGQHIPATLYAAVAEVLAWVYQLKRWKREGGLIPKKPEHLPVPEALDFATESETKSETD 386
108807160 321 ALFRHSEVGQHIPATLYAAVAEVLAWVYQLKRWKREGGLIPKKPEHLPVPEALDFATESETKSETD 386
51596001  321 ALFRHSEVGQHIPATLYAAVAEVLAWVYQLKRWKREGGLIPKKPEHLPVPEALDFATESETKSETD 386
145598622 321 ALFRHSEVGQHIPATLYAAVAEVLAWVYQLKRWKREGGLIPKKPEHLPVPEALDFATESETKSETD 386
123442794 321 ALFRHSEVGQHIPATLYAAVAEVLAWVYQLKRWKREGGLIPKKPEHLPVPEGLDFATE---ESETD 383
153947600 321 ALFRHSEVGQHIPATLYAAVAEVLAWVYQLKRWKREGGLIPKKPEHLPVPEALDFATESEIKSETD 386
157371217 336 ALYRHSEIGQHIPATLYAAVAEVLAWVYQLRRWRREGGLIPKKPERLPVPEALDFAGESDTNG--- 398
170024657 321 ALFRHSEVGQHIPATLYAAVAEVLAWVYQLKRWKREGGLIPKKPEHLPVPEALDFATESETKSETD 386
186895104 321 ALFRHSEVGQHIPATLYAAVAEVLAWVYQLKRWKREGGLIPKKPEHLPVPEALDFATESETKSETD 386
218928912 321 ALFRHSEVGQHIPATLYAAVAEVLAWVYQLKRWKREGGLIPKKPEHLPVPEALDFATESETKSETD 386
294504041 321 ALFRHSEVGQHIPATLYAAVAEVLAWVYQLKRWKREGGLIPKKPEHLPVPEALDFATESETKSETD 386
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap