Conserved Protein Domain Family
PRK12463

?
PRK12463: PRK12463 
chorismate synthase; Reviewed
Statistics
?
PSSM-Id: 171518
View PSSM: PRK12463
Aligned: 19 rows
Threshold Bit Score: 705.346
Threshold Setting Gi: 163940694
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
49479051    1 MRYITAGESHGPQLTVILEGVPAGLTLAAEHINKELLRRQKGHGRGRRMQIETDTVEIVSGVRHGMTLGSPITLIVKNDD 80 
30021057    1 MRYITAGESHGPQLTVILEGVPAGLTLTAEHINKELLRRQKGHGRGRRMQIETDTVEIVSGVRHGMTLGSPITLIVKNDD 80 
42782053    1 MRYITAGESHGPQLTVILEGVPAGLTLAAEHINKELLRRQKGHGRGRRMQIETDTVEIVSGVRHGVTLGSPITLIVKNDD 80 
218233180   1 MRYITAGESHGPQLIVILEGVPAGLTLTAEHINKELLRRQKGHGRGRRMQIETDTVEIVSGVRHGMTLGSPITLIVKNDD 80 
217960391   1 MRYITAGESHGPQLTVILEGVPAGLTLAAEHINKELLRRQKGHGRGRRMQIETDTVEIVSGVRHGMTLGSPITLIVKNDD 80 
218904072   1 MRYITAGESHGPQLTVILEGVPAGLTLTAEHINKELLRRQKGHGRGRRMQIETDTVEIVSGVRHGMTLGSPITLIVKNDD 80 
218898025   1 MRYITAGESHGPQLTVILEGVPAGLTLTAEHINKELLRRQKGHGRGRRMQIETDTVEIVSGVRHGMTLGSPITLIVKNDD 80 
225864921   1 MRYITAGESHGPQLTVILEGVPAGLTLAAEHINKELLRRQKGHGRGRRMQIETDTVEIVSGVRHGMTLGSPITLIVKNDD 80 
222096446   1 MRYITAGESHGPQLTVILEGVPAGLTLAAEHINKELLRRQKGHGRGRRMQIETDTVEIVSGVRHGMTLGSPITLIVKNDD 80 
296503480   1 MRYITAGESHGPQLTVILEGVPAGLTLTAEHINKELLRRQKGHGRGRRMQIETDTVEIVSGVRHGMTLGSPITLIVKNDD 80 
49479051   81 FKHWTKVMGAEPISEKESKEMKRTITKPRPGHADLNGAIKYGHRDIRNVLERSSARETTVRVAAGAVAKQILKELGVEIA 160
30021057   81 FKHWTKVMGAEPISEKESKDMKRTITKPRPGHADLNGAIKYGHRDIRNVLERSSARETTVRVAAGAVAKQILSELGVEIA 160
42782053   81 FKHWTKVMGAEPISEKESKDMKRTITKPRPGHADLNGAIKYGHRDIRNVLERSSARETTVRVAAGAVAKQILKELGVEIA 160
218233180  81 FKHWTKVMGAEPISEKESKDMKRTITKPRPGHADLNGAIKYGHRDIRNVLERSSARETTVRVAAGAVAKQILSELGVEIA 160
217960391  81 FKHWTKVMGAEPISEKESKEMKRTITKPRPGHADLNGAIKYGHRDIRNVLERSSARETTVRVAAGAVAKQILKELGVEIA 160
218904072  81 FKHWTKVMGAEPISEKESKEMKRTITKPRPGHADLNGAIKYGHRDIRNVLERSSARETTVRVAAGAVAKQILKELGVEIA 160
218898025  81 FKHWTKVMGAEPISEKESKDMKRTITKPRPGHADLNGAIKYGHRDIRNVLERSSARETTVRVAAGAVAKQILSELGVEIA 160
225864921  81 FKHWTKVMGAEPISEKESKEMKRTITKPRPGHADLNGAIKYGHRDIRNVLERSSARETTVRVAAGAVAKQILKELGVEIA 160
222096446  81 FKHWTKVMGAEPISEKESKEMKRTITKPRPGHADLNGAIKYGHRDIRNVLERSSARETTVRVAAGAVAKQILKELGVEIA 160
296503480  81 FKHWTKVMGAEPISEKESKDMKRTITKPRPGHADLNGAIKYGHRDIRNVLERSSARETTVRVAAGAVAKQILSELGVEIA 160
49479051  161 GHVLEIGGVKAKHISNLSIEEIQIITENSPVRCLDKTVEQEMMDAIDNAKSSGDSIGGIVEVIAEGMPIGVGSYVHYDRK 240
30021057  161 GHVLEIGGVKAKHISNLSIEEIQTITENSPVRCLDKEVEQEMMNAIDNAKSSGDSIGGIVEVIAEGMPIGVGSYVHYDRK 240
42782053  161 GHVLEIGGVKAKHISNLSIEEIQTITENSPVRCLDKEVEQEMMNAIDHAKSSGDSIGGIVEVIAEGMPIGVGSYVHYDRK 240
218233180 161 GHVLEIGGVKAKHISNLSIEEIQTITENSPVRCLDKEVEQEMMNAIDNAKSSGDSIGGIVEVIAEGMPIGVGSYVHYDRK 240
217960391 161 GHVLEIGGVKAKHISNLSIEEIQTITENSPVRCLDKEVEQEMMDAIDHAKSSGDSIGGIVEVIAEGMPIGVGSYVHYDRK 240
218904072 161 GHVLEIGGVKAKHISNLSIEEIQTITENSPVRCLDKTVEQEMMDAIDNAKSSGDSIGGIVEVIAEGMPIGVGSYVHYDRK 240
218898025 161 GHVLEIGGVKAKHISNLSIEEIQTITENSPVRCLDKEVEQEMMNAIDNAKSSGDSIGGIVEVIAEGMPIGVGSYVHYDRK 240
225864921 161 GHVLEIGGVKAKHISNLSIEEIQTITENSPVRCLDKEVEQEMMDAIDNAKSSGDSIGGIVEVIAEGMPIGVGSYVHYDRK 240
222096446 161 GHVLEIGGVKAKHISNLSIEEIQTITENSPVRCLDKEVEQEMMNAIDNAKSSGDSIGGIVEVIAEGMPIGVGSYVHYDRK 240
296503480 161 GHVLEIGGVKAKHISNLSIEEIQTITENSPVRCLDKEVEQEMMNAIDNAKSSGDSIGGIVEVIAEGMPIGVGSYVHYDRK 240
49479051  241 LDAKLAGAIMSINAFKGAEIGVGFEAARQPGSKVHDEILWDEEQGYTRKTNNAGGLEGGMTTGMPIVVRGVMKPIPTLYK 320
30021057  241 LDAKLAGAIMSINAFKGAEIGVGFEAARQPGSKVHDEILWDEEKGYTRRTNNAGGLEGGMTTGMPIIVRGVMKPIPTLYK 320
42782053  241 LDAKLAGAIMSINAFKGAEIGVGFEAARQPGSKVHDEILWDEEQGYTRKTNNAGGLEGGMTTGMPIVVRGVMKPIPTLYK 320
218233180 241 LDAKLAGAIMSINAFKGAEIGVGFEAARQPGSKVHDEILWDEEKGYTRRTNNAGGLEGGMTTGMPIIVRGVMKPIPTLYK 320
217960391 241 LDAKLAGAIMSINAFKGAEIGVGFEAARQPGSKVHDEILWDEEQGYTRKTNNAGGLEGGMTTGMPIVVRGVMKPIPTLYK 320
218904072 241 LDAKLAGAIMSINAFKGAEIGVGFEAARQPGSKVHDEILWDEEHGYTRKTNNAGGLEGGMTTGMPIVVRGVMKPIPTLYK 320
218898025 241 LDAKLAGAIMSINAFKGAEIGVGFEAARQPGSKVHDEILWDKEKGYTRKTNNAGGLEGGMTTGMPIVVRGVMKPIPTLYK 320
225864921 241 LDAKLAGAIMSINAFKGAEIGVGFEAARQPGSKVHDEILWDEEQGYTRKTNNAGGLEGGMTTGMPIVVRGVMKPIPTLYK 320
222096446 241 LDAKLAGAIMSINAFKGAEIGVGFEAARQPGSKVHDEILWDEEQGYTRKTNNAGGLEGGMTTGMPIVVRGVMKPIPTLYK 320
296503480 241 LDAKLAGAIMSINAFKGAEIGVGFEAARQPGSKVHDEILWDEEKGYTRRTNNAGGLEGGMTTGMPIIVRGVMKPIPTLYK 320
49479051  321 PLASVDIDTKEAFQASIERSDSCAVPAAGVVAESVVAWELAHALVEQFGKDRMELIQQNITQHNKYAKEF 390
30021057  321 PLASVDIDTKEAFQASIERSDSCAVPAAGVVAESVVAWELADALVEQFGKDRMELLKQNIMQHNNYAKEF 390
42782053  321 PLASVDIDTKEAFQASIERSDSCAVPAAGVVAESVVAWELAHALVEQFGKDRMELIQQNITQHNKYAKEF 390
218233180 321 PLASVDIDTKEAFQASIERSDSCAVPAAGVVAESVVAWELADALVEQFGKDRMELLKQNIMQHNNYAKEF 390
217960391 321 PLASVDIDTKEAFQASIERSDSCAVPAAGVVAESVVAWELAHALVEQFGKDRMELIQQNITQHNKYAKEF 390
218904072 321 PLASVDIDTKEAFQASIERSDSCAVPAAGVVAESVVAWELAHALVEQFGKDRMELIQQNITQHNKYAKEF 390
218898025 321 PLASVDIDTKEEFQASIERSDSCAVPAAGVVAESVVAWELADALVEQFGKDRMELLKQNIMQHNNYAKEF 390
225864921 321 PLASVDIDTKEAFQASIERSDSCAVPAAGVVAESVVAWELAHALVEQFGKDRMELIQQNITQHNKYAKEF 390
222096446 321 PLASVDIDTKEAFQASIERSDSCAVPAAGVVAESVVAWELAHALVEQFGKDRMELIQQNITQHNKYAKEF 390
296503480 321 PLASVDIDTKEAFQASIERSDSCAVPAAGVVAESVVAWELADALVEQFGKDRMELLKQNIMQHNNYAKEF 390
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap