Conserved Protein Domain Family
PRK12456

?
PRK12456: PRK12456 
Na(+)-translocating NADH-quinone reductase subunit E; Provisional
Statistics
?
PSSM-Id: 84141
View PSSM: PRK12456
Aligned: 10 rows
Threshold Bit Score: 307.295
Threshold Setting Gi: 51596259
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
51596259    1 MTESYLTIFIRAVFVENMALNFFLGMCTFLAISKKVETAFGLGLTVTALLAIATPLNNLIYTYILRENALIDGVDLSFLD 80 
22126260    9 MTESYLTIFIRAVFVENMALNFFLGMCTFLAISKKVETAFGLGLTVTALLAIATPLNNLIYTYILRENALIDGVDLSFLD 88 
45441491    9 MTESYLTIFIRAVFVENMALNFFLGMCTFLAISKKVETAFGLGLTVTALLAIATPLNNLIYTYILRENALIDGVDLSFLD 88 
108807313   1 MTESYLTIFIRAVFVENMALNFFLGMCTFLAISKKVETAFGLGLTVTALLAIATPLNNLIYTYILRENALIDGVDLSFLD 80 
145598482   1 MTESYFTIFIRAVFVENMALNFFLGMCTFLAISKKVETAFGLGLTVTALLAIATPLNNLIYTYILRENALIDGVDLSFLD 80 
153949214   1 MTESYLTIFIRAVFVENMALNFFLGMCTFLAISKKVETAFGLGLTVTALLAIATPLNNLIYTYILRENALIDGVDLSFLD 80 
162420222   1 MTESYLTIFIRAVFVENMALNFFLGMCTFLAISKKVETAFGLGLTVTALLAIATPLNNLIYTYILRENALIDGVDLSFLD 80 
170024487   1 MTESYLTIFIRAVFVENMALNFFLGMCTFLAISKKVETAFGLGLTVTALLAIATPLNNLIYTYILRENALIDGVDLSFLD 80 
186895293   1 MTESYLTIFIRAVFVENMALNFFLGMCTFLAISKKVETAFGLGLTVTALLAIATPLNNLIYTYILRENALIDGVDLSFLD 80 
218929049   1 MTESYLTIFIRAVFVENMALNFFLGMCTFLAISKKVETAFGLGLTVTALLAIATPLNNLIYTYILRENALIDGVDLSFLD 80 
51596259   81 FITFIGVLAALVQILEMVLERFLPSLHHTLGAFLPLLTIHCAIFGATIFMVQREYTFTESFVYGTGCGLGWMLAIISMAG 160
22126260   89 FITFIGVLAALVQILEMVLERFLPSLHHTLGAFLPLLTIHCAIFGATIFMVQREYTFTESFVYGTGCGLGWMLAIISMAG 168
45441491   89 FITFIGVLAALVQILEMVLERFLPSLHHTLGAFLPLLTIHCAIFGATIFMVQREYTFTESFVYGTGCGLGWMLAIISMAG 168
108807313  81 FITFIGVLAALVQILEMVLERFLPSLHHTLGAFLPLLTIHCAIFGATIFMVQREYTFTESFVYGTGCGLGWMLAIISMAG 160
145598482  81 FITFIGVLAALVQILEMVLERFLPSLHHTLGAFLPLLTIHCAIFGATIFMVQREYTFTESFVYGTGCGLGWMLAIISMAG 160
153949214  81 FITFIGVLAALVQILEMVLERFLPSLHHTLGAFLPLLTIHCAIFGATIFMVQREYTFTESFVYGTGCGLGWMLAIISMAG 160
162420222  81 FITFIGVLAALVQILEMVLERFLPSLHHTLGAFLPLLTIHCAIFGATIFMVQREYTFTESFVYGTGCGLGWMLAIISMAG 160
170024487  81 FITFIGVLAALVQILEMVLERFLPSLHHTLGAFLPLLTIHCAIFGATIFMVQREYTFTESFVYGTGCGLGWMLAIISMAG 160
186895293  81 FITFIGVLAALVQILEMVLERFLPSLHHTLGAFLPLLTIHCAIFGATIFMVQREYTFTESFVYGTGCGLGWMLAIISMAG 160
218929049  81 FITFIGVLAALVQILEMVLERFLPSLHHTLGAFLPLLTIHCAIFGATIFMVQREYTFTESFVYGTGCGLGWMLAIISMAG 160
51596259  161 LREKMKYSNIPKGLQGLGIVFMTAGLMSLGFMSFSGIRL 199
22126260  169 LREKMKYSNIPKGLQGLGIVFMTAGLMSLGFMSFSGIRL 207
45441491  169 LREKMKYSNIPKGLQGLGIVFMTAGLMSLGFMSFSGIRL 207
108807313 161 LREKMKYSNIPKGLQGLGIVFMTAGLMSLGFMSFSGIRL 199
145598482 161 LREKMKYSNIPKGLQGLGIVFMTAGLMSLGFMSFSGIRL 199
153949214 161 LREKMKYSNIPKGLQGLGIVFMTAGLMSLGFMSFSGIRL 199
162420222 161 LREKMKYSNIPKGLQGLGIVFMTAGLMSLGFMSFSGIRL 199
170024487 161 LREKMKYSNIPKGLQGLGIVFMTAGLMSLGFMSFSGIRL 199
186895293 161 LREKMKYSNIPKGLQGLGIVFMTAGLMSLGFMSFSGIRL 199
218929049 161 LREKMKYSNIPKGLQGLGIVFMTAGLMSLGFMSFSGIRL 199
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap