Conserved Protein Domain Family
PRK12452

?
PRK12452: PRK12452 
cardiolipin synthase
Links
?
Statistics
?
PSSM-Id: 171510
View PSSM: PRK12452
Aligned: 20 rows
Threshold Bit Score: 911.224
Threshold Setting Gi: 172057275
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
49480214    1 MKKPIIQLLLIFTIVSIVLFLLNTSYISLYTFVGVLWSITIVGISFVIFIENRSPQSTLAWFLVLALLPVIGVLLYSIFG 80 
42779772    1 MKKPIVQLLLIFTIVSIVLFLLNTSYISLYTFVGVLWSITIVGISFVIFIENRSPQSTLAWFLVLALLPVVGVLLYSIFG 80 
30018811    1 MKKPIVQLLLIFTIVSIVLFLLNTSYISLYTFVGALWSITIVGISFVIFIENRSPQSTLAWFLVLALLPIIGVLLYAIFG 80 
163938549   1 MKKPIVQLLLIFTIVSIVLFLLNTSVISLYTFVGALWSITIVGISFVIFIENRSPQSTLAWFLVLALLPVVGVLLYSIFG 80 
217958213   1 MKKPIVQLLLIFTIVSIVLFLLNTSYISLYTFVGVLWSITIVGISFVIFIENRSPQSTLAWFLVLALLPVVGVLLYSIFG 80 
218233854   1 MKKPIVQLLLIFTIVSIVLFLLNTSYISLYTFVGALWSITIVGISFVIFIENRSPQSTLAWFLVLALLPIIGVLLYAIFG 80 
218895681   1 MKKPIVQLLLIFTIVSIVLFLLNTSYISLYTFVGALWSITIVGISFVIFIENRSPQSTLAWFLVLALLPIIGVLLYAIFG 80 
222094377   1 MKKPIVQLLLIFTIVSIVLFLLNTSYISLYTFVGVLWSITIVGISFVIFIENRSPQSTLAWFLVLALLPVVGVLLYSIFG 80 
225862600   1 MKKPIVQLLLIFTIVSIVLFLLNTSYISLYTFVGVLWSITIVGISFVIFIENRSPQSTLAWFLVLALLPVIGVLLYSIFG 80 
296501386   1 MKKPIVQLLLIFTIVSIVLFLLNTSYISLYTFVGALWSITIVGISFVIFIENRSPQSTLAWFLVLALLPIIGVLLYAIFG 80 
49480214   81 RSRWRRKKHLHRSEEQRKLFREILEGRRLELSLKVPLSERSVHLTEVVQKFGGGPAADRTTTKLLTNGDQTFSEILQAIE 160
42779772   81 RSRWRRKKHLHRSEEQRKLFREILEGRRLELSLKVPLSERSTHLTEVVQKFGGGPAADRTTTKLLTNGDQTFSEILQAIE 160
30018811   81 RSRWRRKKHLHRSEEQRKLFREILEGRRLELLLTVPLNERSIHLTEVIQKFGGGPAADRTTTKLLTNGDQTFSEILRAIE 160
163938549  81 RSRWRRKKHLHRSEEQRKLFREILEGRRLELSLTVPLHERSIHLTEVLQKFGGGPAADRTTTKLLTNGDQTFSEILNAIE 160
217958213  81 RSRWRRKKHLHRSEEQRKLFREILEGRRLELSLKVPLSERSTHLTEVVQKFGGGPAADRTTTKLLTNGDQTFSAILQAIE 160
218233854  81 RSRWRRKKHLHRSEEQRKLFREILEGRRLELLLTVPLNERSIHLTEVIQKFGGGPAADRTTTKLLTNGDQTFSEILRAIE 160
218895681  81 RSRWRRKKHLHRSEEQRKLFREILEGRRLELLLTVPLNERSIHLTEVIQKFGGGPAADKTTTKLLTNGDQTFSEILRAIE 160
222094377  81 RSRWRRKKHLHRSEEQRKLFREILEGRRLELSLKVPLSERSTHLTEVVQKFGGGPAADRTTTKLLTNGDQTFSAILQAIE 160
225862600  81 RSRWRRKKHLHRSEEQRKLFREILEGRRLELSLKVPLNERSVHLTEVVQKFGGGPAADRTTTKLLTNGDQTFSEILQAIE 160
296501386  81 RSRWRRKKHLHRSEEQRKLFREILEGRRLELLLTVPLNERSIHLTEVIQKFGGGPAADKTTTKLLTNGDQTFSEILRAIE 160
49480214  161 QAKHHIHIQYYIYKSDEIGTKVRDALIKKAKDGVIVRFLYDGLGSNTLRRRFLQPMKEAGIEIVEFDPIFSAWLLETVNY 240
42779772  161 QAKHHIHIQYYIYKSDEIGTKVRDALINKAKAGVIVRFLYDGLGSNTLRRRFLKPMKEAGIEIVEFDPIFSAWLLETVNY 240
30018811  161 QAKHHIHIQYYIYKSDEIGTKVRDALIQKAKDGVIVRFLYDGLGSNTLRRRFLQPMKEAGIEIVEFDPIFSAWLLETVNY 240
163938549 161 NAKHHIHIQYYIYKSDEIGTKVRDALIQKAKDGVIVRFLYDGLGSNTLRRRFLQPMKKAGIEIVEFDPIFSAWLLETVNY 240
217958213 161 QAKHHIHIQYYIYKSDEIGTKVRDALINKAKAGVIVRFLYDGLGSNTLRRRFLKPMKEAGIEIVEFDPIFSAWLLETVNY 240
218233854 161 QAKHHIHIQYYIYKSDEIGTKVRDALIQKAKDGVIVRFLYDGLGSNTLRRRFLQPMKEAGIEIVEFDPIFSAWLLETVNY 240
218895681 161 QAKHHIHIQYYIYKSDEIGTKVRDALIQKAKDGVIVRFLYDGLGSNTLRRRFLQPMKEAGIEIVEFDPIFSAWLLETVNY 240
222094377 161 QAKHHIHIQYYIYKSDEIGTKVRDALINKAKAGVIVRFLYDGLGSNTLRRRFLKPMKEAGIEIVEFDPIFSAWLLETVNY 240
225862600 161 QAKHHIHIQYYIYKSDEIGTKVRDALIKKAKSGVIVRFLYDGLGSNTLRRRFLQPMKEAGIEIVEFDPIFSAWLLETVNY 240
296501386 161 QAKHHIHIQYYIYKSDEIGTKVRDALIQKAKDGVIVRFLYDGLGSNTLRRRFLQPMKEAGIEIVEFDPIFSAWLLETVNY 240
49480214  241 RNHRKIVIVDGEIGFTGGLNVGDEYLGRSKKFPVWRDSHLKVEGKALYKLQAIFLEDWLYASSGLNTYSWDPFMNRQYFP 320
42779772  241 RNHRKIVIVDGEIGFTGGLNVGDEYLGRSKKFPVWRDSHLKIEGKALYKLQAIFLEDWLYASSGLKTYSWDQFMNRQYFP 320
30018811  241 RNHRKIVIVDGEIGFTGGLNVGDEYLGRSKKFPVWRDSHLKIEGKALYKLQAIFLEDWLYASSGLNTYSWDQFMNRQYFP 320
163938549 241 RNHRKIVIVDGEIGFTGGLNVGDEYLGRSKKFPVWRDSHLKIEGKALYKLQAIFLEDWLYASSGLNTYSWDQFMNRHYFP 320
217958213 241 RNHRKIVIVDGEIGFTGGLNVGDEYLGRSKKFPVWRDSHLKLEGKALYKLQAIFLEDWLYASSGLKTYSWDQFMNRQYFP 320
218233854 241 RNHRKIVIVDGEIGFTGGLNVGDEYLGRSKKFPVWRDSHLKIEGKALYKLQAIFLEDWLYASSGLNTYSWDQFMNRQYFP 320
218895681 241 RNHRKIVIVDGEIGFTGGLNVGDEYLGRSKKFPVWRDSHLKIEGKALYKLQAIFLEDWLYASSGLNTYSWDQFMNRQYFP 320
222094377 241 RNHRKIVIVDGEIGFTGGLNVGDEYLGRSKKFPVWRDSHLKLEGKALYKLQAIFLEDWLYASSGLKTYSWDQFMNRQYFP 320
225862600 241 RNHRKIVIVDGEIGFTGGLNVGDEYLGRSKKFPVWRDSHLKIEGKALYKLQAIFLEDWLYASSGLNTYSWDPFMNRQYFP 320
296501386 241 RNHRKIVIVDGEIGFTGGLNVGDEYLGRSKKFPVWRDSHLKIEGKALYKLQAIFLEDWLYASSGLNTYSWDHFMNRQYFP 320
49480214  321 GKEISNAEGAVQIVASGPSSDDKSIRNTLLAVMGSAKKSIWIATPYFIPDQETLTLLRLSAISGIDVRILYPGKSDSIIS 400
42779772  321 GKEVSSAEGAVQIVASGPSSDDKSIRNTLLAIMGSAKKSIWIATPYFIPDQETLTLLRLSAISGIDVRILYPGKSDSIIS 400
30018811  321 GKEISNAEGAVQIVASGPSSDDKSIRNTLLAVMGSAKKSIWIATPYFIPDQETLTLLRLSAIAGIDVRILYPGKSDSIIS 400
163938549 321 GKEIPDAEGAVQIVASGPSSDDKSIRNTLLAVMGSAKKSIWIATPYFIPDQETLTLLRLSAISGIDVRILYPGKSDSIIS 400
217958213 321 GKEISSAEGAVQIVASGPSSDDKSIRNTLLAVMGSAKKSIWIATPYFIPDQETLTLLRLSAISGIDVRILYPGKSDSIIS 400
218233854 321 GKEISNAEGAVQIVASGPSSDDKSIRNTLLAVMGSAKKSIWIATPYFIPDQETLTLLRLSAIAGIDVRILYPGKSDSIIS 400
218895681 321 GKEISHAEGAVQIVASGPSSDDKSIRNTLLAVMGSAKKSIWIATPYFIPDQETLTLLRLSAIAGIDVRILYPGKSDSIIS 400
222094377 321 GKEISSAEGAVQIVASGPSSDDKSIRNTLLAVMGSAKKSIWIATPYFIPDQETLTLLRLSAISGIDVRILYPGKSDSIIS 400
225862600 321 GKEISSAEGAVQIVASGPSSDDKSIRNTLLAVMGSAKKSIWIATPYFIPDQETLTLLRLSAISGIDVRILYPGKSDSIIS 400
296501386 321 GKEILNAEGAVQIVASGPSSDDKSIRNTLLAVMGSAKKSIWIATPYFIPDQETLTLLRLSAIAGIDVRILYPGKSDSIIS 400
49480214  401 DQASQSYFTPLLKAGASIYSYKDGFMHAKIVLVDDKIATIGTANMDVRSFELNYEIISVLYESETVHDIKRDFEDDFKHS 480
42779772  401 DQASQSYFTPLLKAGASIYSYKDGFMHAKLVLVDDKIATIGTANMDVRSFELNYEIISVLYESKTVHDIKRDFEEDFKHS 480
30018811  401 DQASQSYFTPLLKAGASIYSYKDGFMHAKIVLVDDTIATIGTANMDVRSFELNYEIISVLYESKTVHDIKRDFEEDFKHS 480
163938549 401 DQASQSYFTPLLKAGASIYSYKDGFMHAKIVLVDDKIATIGTANMDVRSFELNYEIISVLYESETVHDIKRDFEEDFKHS 480
217958213 401 DQASQSYFTPLLKAGASIYSYKDGFMHAKIVLVDDKIATIGTANMDVRSFELNYEIISVLYESETVHNIKRDFEEDFKHS 480
218233854 401 DQASQSYFTPLLKAGASIYSYKDGFMHAKIVLVDDTIATIGTANMDVRSFELNYEIISVLYESKTVHDIKRDFEEDFKHS 480
218895681 401 DQASQSYFTPLLKAGASIYSYKDGFMHAKIVLVDDTIATIGTANMDVRSFELNYEIISVLYESKTVHDIKRDFEKDFKHS 480
222094377 401 DQASQSYFTPLLKAGASIYSYKDGFMHAKIVLVDDKIATIGTANMDVRSFELNYEIISVLYESETVHNIKRDFEEDFKHS 480
225862600 401 DQASQSYFTPLLKAGASIYSYKDGFMHAKIVLVDDKIATIGTANMDVRSFELNYEIISVLYESETVHDIKRDFEDDFKHS 480
296501386 401 DQASQSYFTPLLKAGASIYSYKDGFMHAKIVLVDDTIATIGTANMDVRSFELNYEIISVLYESKTVHDIKRDFEEDFKHS 480
49480214  481 TEIKWNAFQKRSIKKRILESFMRLISPLL 509
42779772  481 TEIKWNAFQKRSIKKRILESFMRLISPLL 509
30018811  481 TEIKWNSFQKRSIKKRILESFMRLISPLL 509
163938549 481 TEIKWNSFQKRSIKKRILESFMRLISPLL 509
217958213 481 TEIKWNAFQKRSIKKRILESFMRLISPLL 509
218233854 481 TEIKWNSFQKRSIKKRILESFMRLISPLL 509
218895681 481 TEIKWNSFQKRSIKKRILESFMRLISPLL 509
222094377 481 TEIKWNAFQKRSIKKRILESFMRLISPLL 509
225862600 481 TEIKWNAFQKRSIKKRILESFMRLISPLL 509
296501386 481 TEIKWNSFQKRSIKKRILESFMRLISPLL 509
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap