Conserved Protein Domain Family
PRK12450

?
PRK12450: PRK12450 
foldase protein PrsA; Reviewed
Statistics
?
PSSM-Id: 138982
View PSSM: PRK12450
Aligned: 16 rows
Threshold Bit Score: 471.496
Threshold Setting Gi: 225868897
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15675810    1 MKQMNKLITGVVTLATVVTLSACQSSHNNTKLVSMKGDTITVSDFYNETKNTELAQKAMLSLVISRVFETQYANKVSDKE 80 
94991309    8 MKQMNKLITGVVTLATVVTLSACQSSHNNTKLVSMKGDTITVSDFYNETKNTELAQKAMLSLVISRVFETQYANKVSDKE 87 
94989370    9 MKQMNKLITGVVTLATVVTLSACQSSHNNTKLVSMKGDTITVSDFYNETKNTELAQKAMLSLVISRVFETQYANKVSDKE 88 
19746923    1 MKQMNKLITGVVTLATVVTLSACQSSHNNTKLVSMKGDTITVSDFYNETKNTELAQKAMLSLVISRVFETQYANKVSDKE 80 
94993261    9 MKQMNKLITGVVTLATVVTLSACQSSHNNTKLVSMKGDTITVSDFYNETKNTELAQKAMLSLVISRVFETQYANKVSDKE 88 
94995221    9 MKQMNKLITGVVTLATVVTLSACQSSHNNTKLVSMKGDTITVSDFYNETKNTELAQKAMLSLVISRVFETQYANKVSDKE 88 
71911545    1 MKQMNKLITGVVTLATVVTLSACQSSHNNTKLVSMKGDTITVSDFYNETKNTELAQKAMLSLVISRVFETQYANKVSDKE 80 
50915078    9 MKQMNKLITGVVTLATVVTLSACQSSHNNTKLVSMKGDTITVSDFYNETKNTELAQKAMLSLVISRVFETQYANKVSDKE 88 
139474495   1 MKQMNKLITGVVTLATVVTLSACQSSHNNTKLVSMKGDTITVSDFYNETKNTELAQKAMLSLVISRVFETQYANKVSDKE 80 
195977800   1 MKKSTKLLAGIVTLASAMTLAACQSTNDNTSVITMKGDTISVSDFYNETKNTEISQRAMLNLVVSRVFEDQYGKKVSKKK 80 
15675810   81 VEKAYKQTADQYGTSFKTVLAQSGLTPETYKKQIRLTKLVEYAVKEQAKNETISKKDYRQAYDAYTPTMTAEIMQFEKEE 160
94991309   88 VEKAYKQTADQYGTSFKTVLAQSGLTPETYKKQIRLTKLVEYAVKEQAKNETISKKDYRQAYDAYTPTMTAEIMQFEKEE 167
94989370   89 VEKAYKQTADQYGTSFKTVLAQSGLTPETYKKQIRLTKLVEYAVKEQAKNETISKKDYRQAYDAYTPTMTTEIMQFEKEE 168
19746923   81 VEKAYKQTADQYGTSFKTVLAQSGLTPETYKKQIRLTKLVEYAVKEQAKNETISKKDYRQAYDAYTPTMTAEIMQFEKEE 160
94993261   89 VEKAYKQTADQYGTSFKTVLAQSGLTPETYKKQIRLTKLVEYAVKEQAKNETISKKDYRQAYDAYTPTMTTEIMQFEKEE 168
94995221   89 VEKAYKQTADQYGTSFKTVLAQSGLTPETYKKQIRLTKLVEYAVKEQAKNETISKKDYRQAYDAYTPTMTAEIMQFEKEE 168
71911545   81 VEKAYKQTADQYGTSFKTVLAQSGLTPETYKKQIRLTKLVEYAVKEQAKNETISKKDYRQAYDAYTPTMTAEIMQFEKEE 160
50915078   89 VEKAYKQTADQYGTSFKTVLAQSGLTPETYKKQIRLTKLVEYAVKEQAKNETISKKDYRQAYDAYTPTMTAEIMQFEKEE 168
139474495  81 VEKAYKQTADQYGTSFKTVLAQSGLTPETYKKQIRLTKLVEYAVKEQAKNETISKKDYRQAYDAYTPTMTAEIMQFEKEE 160
195977800  81 TEEAYNKSAEQYGASFSAALAQSGLTTDTYKRQIRSAMLVEYAVKEAAKKE-LTDADYKKAYESYTPEMTTQVITLDNEE 159
15675810  161 DAKAALEAVKAEGADFAAIAKEKTTAADKKTTYTFDSGETTLPAEVVRAASGLKEGNRSEIITALDPATSKRTYHIIKVT 240
94991309  168 DAKAALEAVKAEGADFAAIAKEKTIAADKKTTYTFDSGETTLPAEVVRAASGLKEGNRSEIITALDPATSKRTYHIIKVT 247
94989370  169 DAKAALEAVKAEGADFAAIAKEKTIAADKKITYTFDSGETTLPAEVVRAASGLKEGNRSEIITALDPATSKRTYHIIKVT 248
19746923  161 DAKAALEAVKAEGADFAAIAKEKTTAADKKTTYTFDSGETTLPAEVVRAASGLKEGNRSEIITALDPATSKRTYHIIKVT 240
94993261  169 DAKAALEAVKAEGADFAAIAKEKTIAADKKITYTFDSGETTLPAEVVRAASGLKEGNRSEIITALDPATSKRTYHIIKVT 248
94995221  169 DAKAALEAVKAEGADFAAIAKEKTIAADKKTTYTFDSGETTLPAEVVRAASGLKEGNRSEIITALDPAISKRTYHIIKVT 248
71911545  161 DAKAALEAVKAEGADFAAIAKEKTTAADKKTTYTFDSGETTLPAEVVRAASGLKEGNRSEIITALDPATSKRTYHIIKVT 240
50915078  169 DAKAALEAVKAEGADFAAIAKEKTIAADKKTTYTFDSGETTLPAEVVRAASGLKEGNRSEIITALDPAISKRTYHIIKVT 248
139474495 161 DAKAALEAVKAEGADFAAIAKEKTIAADKKTTYTFDSGETTLPAEVVRAASGLKEGNRSEIITALDPAISKRTYHIIKVT 240
195977800 160 TAKAILGEVKAEGADFAAIAKEKTTAADKKVDYKFDSGDTKLPADVIKAASGLKEGDISEVVSVLDPATYQNKFYIVKVT 239
15675810  241 KKATKKADWKAYQKRLKDIIVTGKLKDPDFQNKVIAKALDKANVKIKDKAFANILAQFAKPNQKQPAQK 309
94991309  248 QKATKKADWKAYQKRLKDIIVTGKLKDPDFQNKVIAKALDKANVKIKDKAFANILAQFAKPNQKQPAQK 316
94989370  249 KKATKKADWKAYQKRLKDIIVTGKLKDPDFQNKVIAKALDKANVKIKDKAFANILAQFAKPNQKQPAQK 317
19746923  241 KKATKKADWKAYQKRLKDIIVTGKLKDPDFQNKVIAKALDKANVKIKDKAFANILAQFAKPNQKQPAQK 309
94993261  249 KKATKKADWKAYQKRLKDIIVTGKLKDPDFQNKVIAKALDKANVKIKDKAFANILAQFAKPNQKQPAQK 317
94995221  249 KKATKKADWKAYQKRLKDIIVTGKLKDPDFQNKVIAKALDKANVKIKDKAFANILAQFAKPNQKQPAQK 317
71911545  241 KKATKKADWKAYQKRLKDIIVTGKLKDPDFQNKVIAKALDKANVKIKDKAFANILAQFAKPNQKQPAQK 309
50915078  249 KKATKKADWKAYQKRLKDIIVTGKLKDPDFQNKVIAKALDKANVKIKDKAFANILAQFAKPNQKQPAQK 317
139474495 241 KKATKKADWKAYQKRLKDIIVTGKLKDPDFQNKVIAKALDKANVKIKDKAFANILAQFAKPNQKQPAQK 309
195977800 240 KKAEKASDWKKYKKRLKEIVLAEKTQNIDFQNKVIAKALDKANVKIKDQAFANILAQYANTDKKASKAN 308
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap