Conserved Protein Domain Family
PRK12446

?
PRK12446: PRK12446 
undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed
Statistics
?
PSSM-Id: 171505
View PSSM: PRK12446
Aligned: 26 rows
Threshold Bit Score: 629.196
Threshold Setting Gi: 218899419
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
52141246    1 MKKIVFTGGGSAGHVTPNLAIIPYLKEDNWDISYIGSHQGIEKTIIEKEDILYYSIASGKLRRYFDLKNIKDPFLVMKGV 80 
30021842    2 SKTILFTGGGTAGHVMINIVLIPKFIEKGWRVEYIGSKNGIEKSLV--QNVKYNSVSTGKLRRYWDWDNFKDPFKIIRGC 79 
118478972   2 NKKILFTGGGTAGHVMINMVLIPKFMGKGWGVEYIGSQNGIEKLLV--QNVKYNSISTGKLRRYWDWENFKDPFKIIKGC 79 
163942013   1 MKKIVFTGGGSAGHVTPNLAIIPHLQKQNWDISYIGSHQGIEKTIIEKEGIPYHSIASGKLRRYFDLKNIKDPFLVMKGV 80 
218231507   2 SKTILFTGGGTAGHVMINIVLIPKFIEKGWRVEYIGSKNGIEKSLV--QNVKYNSVSTGKLRRYWDWENFKDPFKIIRGC 79 
218898850   2 SKTILFTGGGTAGHVMINIVLIPKFIEQGWRVEYIGSKNGIEKSLV--KNVKYNSVSTGKLRRYWDWENFKDPFKIISGC 79 
218899419   1 MKKIVFTGGGSAGHVTPNLAIIPHLQEDNWDISYIGSHQGIEKTIIEKEGIPYYSISSGKLRRYFDLKNIKDPFLVMKGV 80 
225865729   2 NKKILFTGGGTAGHVMINMVLIPKFMGKGWGVEYIGSQNGIEKLLV--QNVKYNSISTGKLRRYWDWENFKDPFKIIKGC 79 
296504251   2 SKTILFTGGGTAGHVMINIVLIPKFIEKGWRVEYIGSKNGIEKSLV--QNVKYNSVSTGKLRRYWDWENFKDPFKIIRGC 79 
296504750   1 MKKIVFTGGGSAGHVTPNLAIIPYLQEDNWDISYIGSHQGIEKTIIEKEGIPYYSISSGKLRRYFDLKNIKDPFLVMKGV 80 
52141246   81 MDAYVRIRKLKPDVIFSKGGFVSVPVVIGGWLNRVPVLLHESDMTPGLANKIALRFASKIFVTFEEAAKHLPKEKVIYTG 160
30021842   80 LQSYNLIKKTKPDVIFSAGGFVSVPVAIGAWLNRVPIIIREPDSTLGLANKIALPFATKLCTTFPQTGENVSNEKKVYVG 159
118478972  80 IQSYKLMKRIKPDVIFSAGGFVSVPVVIGAWMNKVPVIIREPDSTLGLANKIALPFTTKLCTTFPQTGENVSNEKKVYVG 159
163942013  81 MDAYVTIRKLKPDVIFSKGGFVSVPVVIGGWLNRVPVLLHESDMTPGLANKIALRFASKIFVTFEEAAKHLPKEKVIYTG 160
218231507  80 LQSYNLIKKTKPDVIFSAGGFVSVPVAIGAWLNRVPIIIREPDSTLGLANKIALPFATKLCTTFPQTGENVSNEKKVYVG 159
218898850  80 LQSYKLIKKTKPDVIFSAGGFVSVPVAIGAWLNRVPIIIREPDSTLGLANKIALPFATKLCTTFPQTGENVSNEKKVYVG 159
218899419  81 MDAYVRIRKLKPDVIFSKGGFVSVPVVIGGWLNRVPVLLHESDMTPGLANKIALRFASKIFVTFEEAAKHLPKGKVIYTG 160
225865729  80 IQSYKLMKRIKPDVIFSAGGFVSVPVVIGAWMNKVPVIIREPDSTLGLANKIALPFTTKLCTTFPQTGENVSNEKKVYVG 159
296504251  80 LQSYNLIKKTKPDVIFSAGGFVSVPVAIGAWLNRVPIIIREPDSTLGLANKIALPFATKLCTTFPQTGENVSNEKKVYVG 159
296504750  81 MDAYVRIRKLKPDVIFSKGGFVSVPVVIGGWLNRVPVLLHESDMTPGLANKIALRFASKIFVTFEEAAKHLPKEKVIYTG 160
52141246  161 SPVREEVLKGNREKALAFLGFSRKKPVITIMGGSLGAKKINETVREALPELLRKYQIVHLCGRGNLDDSLQNKEGYRQFE 240
30021842  160 PIVRVEIEKGNVLRGRRYCEFQQDKPVLLIMGGSQGAKWINDMVRECLDTILLNFNIIHICGKGKVDPSI-GMEGYMQFE 238
118478972 160 PIVREEIERGNVLRGRSYCKFQQDKPVLLIMGGSQGAQWINDMVRGSLETLLLNFNIVHMCGKGKVDSSI-GMEGYIQFE 238
163942013 161 SPVREDVLRGNLEKGLKFLGFSRKKSVITVMGGSLGAKKINETVRSALPDLLKNYQIVHLCGKGNLDESLQNKEGYRQFE 240
218231507 160 PIVREEIEKGNVLRGRRYCEFQQDKPVLLIMGGSQGAKWINDMVRECVDTILLNFNIIHICGKGKVDPSI-GMEGYMQFE 238
218898850 160 PIVREEIEKGNVLRGRRYCEFQQDKPVLLIMGGSQGAKWINDMVRKCLDTILLNFNIIHICGKGKVDPSI-GMEGYMQFE 238
218899419 161 SPVREEVLKGNSETGLAFLGFSRKKPVITIMGGSLGAKKINDTAREALPELLKKYQIVHLCGKGNLDESLQNKEGYRQFE 240
225865729 160 PIVREEIERGNVLRGRSYCKFQQDKPVLLIMGGSQGAQWINDMVRGSLETLLLNFNIVHMCGKGKVDSSI-GMEGYIQFE 238
296504251 160 PIVREEIEKGNVLRGRRYCEFQQDKPVLLIMGGSQGAKWINDMVRECLDTILLNFNIIHICGKGKIDPSI-GMEGYMQFE 238
296504750 161 SPVREEVLKGNREKGLAFLGFSRKKPVITIMGGSLGAKKINDTAREALPELLKKYQIVHLCGKGNLDESLQNKEGYRQFE 240
52141246  241 YVHGELPDILAITDFVISRAGSNAIFEFLTLQKPMLLIPLSKFASRGDQILNAESFERQGYASVLYEEDVTVNSLIKHVE 320
30021842  239 YIGDELPHILNMASVVVSRAGSTAISELLFLKKPMLLIPLTNSSSRGDQVLNAEYFSRQGYAEVILQDRVSTNTFIHAVN 318
118478972 239 YIGEELPHILNMASVVVSRAGSTAIFELLFLKKPMLLIPLTNSSSRGDQVLNAEYFSRQGYAEVILQDRVSTNTFIHAVN 318
163942013 241 YVHEELPDILAATDFVISRAGSNAIFEFLTMQKPMVLIPLSKFASRGDQILNAESFKRQGYASVLYEEDVTVNSLIKHIE 320
218231507 239 YIGDELPHILNMASVVVSRAGSTAISELLFLKKPMLLIPLTNSSSRGDQVLNAEYFSRQGYAEVILQDRVSTNTFIHAVN 318
218898850 239 YIGDELPHILNMASVVVSRAGSTAISELLFLKKPMLLIPLTNSSSRGDQGLNAEYFSRQGYAEVILQDRVNTNTFIHAVN 318
218899419 241 YVHGELPDILAVTDFVISRAGSNAIFEFLTLQKPMVLIPLSKFASRGDQILNAESFERQGYASVLYEEDVTVKSLIKYVE 320
225865729 239 YIGEELPHILNMASVVVSRAGSTAIFELLFLKKPMLLIPLTNSSSRGDQVLNAEYFSRQGYAEVILQDRVSTNTFIHAVN 318
296504251 239 YIGDELPHILNMASVVVSRAGSTAISELLFLKKPMLLIPLTNSSSRGDQVLNAEYFSRQGYAEVILQDRVSTNTFIHAVN 318
296504750 241 YVHGELPDILAVTDFVISRAGSNAIFEFLTLQKPMVLIPLSKFASRGDQILNAESFERQGYASVLYEEDVNVKSLIKYVE 320
52141246  321 ELSHNNEAYKTALKKYN--GKEAIQTIIHHISEA 352
30021842  319 KLYTNKEKYIQNMNGYKktNDEGIHQIIDIINEV 352
118478972 319 KLNTNKERYIQNMNGYTktNDEGIHQLIDIINEV 352
163942013 321 ELSHNNETYKTALKKYN--GKEAIKTIIQHISEA 352
218231507 319 KLYTNKEKYIQNMNGYKktNDEGIHQIIDIINEV 352
218898850 319 KLYTNQEKYIQNMNEYKktNDEGIHQLVDIINDV 352
218899419 321 ELNQNNEKYKTALKKYN--GKEAIQTIIQNISEA 352
225865729 319 KLNTNKERYIQNMNGYTktNDEGIHQLIDIINEV 352
296504251 319 KLYTNKEKYIQNMNGYKktNDEGIHQIIDIINEV 352
296504750 321 ELNQNNEKYKIALKKYN--GKEAIKTIIQNISEA 352
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap