Conserved Protein Domain Family
PRK12445

?
PRK12445: PRK12445 
lysyl-tRNA synthetase; Reviewed
Statistics
?
PSSM-Id: 171504
View PSSM: PRK12445
Aligned: 34 rows
Threshold Bit Score: 981.473
Threshold Setting Gi: 218549238
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
74314615    1 MSEQETRGANEAIDFNDELRNRREKLAALRQQGVAFPNDFRRDHTSDQLHEEFDAKNNQELESLNIEVSVAGRMMTRRIM 80 
152969073   1 MSEQQAQGADEAIDLNNELKARREKLAALREQGVAFPNDFRRDHTSDQLHAEFDAKDNDELASLNVEVAVAGRMMTRRVM 80 
170682016   1 MSERETRGANEAIDFNDELRNRREKLAALRQQGVAFPNDFRRDHTSDQLHDEFDAKDNQELESLNIEVSVAGRMMTRRIM 80 
206580188   1 MSEQQAQGADEAIDLNNELKTRREKLAALREQGVAFPNDFRRDHTSDQLHAEFDAKDNDELASLNVEVAVAGRMMTRRVM 80 
215489478   1 MSERETRGANEAIDFNDELRNRREKLAALRQQGVAFPNDFRRDHTSDQLHEEFDAKDNQELESLNIEVSVAGRMMTRRIM 80 
218549238   1 MSEREAQGANEAIDLNDELRNRREKLAALRQQGVAFPNDFRRDSTSDQLHAEYDEKDNQELESLNIEVSVAGRMMTRRIM 80 
218561217   1 MSERETRGANEAIDFNDELRNRREKLAALRQQGVAFPNDFRRDHTSDQLHEEFDAKDNQELESLNIEVSVAGRMMTRRIM 80 
218702794   1 MSERETRGANEAIDFNDELRNRREKLAALRQQGVAFPNDFRRDHTSDQLHEEFDAKDNQELEALNIEVSVAGRMMTRRIM 80 
218707745   1 MSERETRGANEAIDFNDELRNRREKLAALRQQGVAFPNDFRRDHTSDQLHEEFDAKDNQELESLNIEVSVAGRMMTRRIM 80 
238893514   1 MSEQQAQGADEAIDLNNELKARREKLAALREQGVAFPNDFRRDHTSDQLHAEFDAKDNDELASLNVEVAVAGRMMTRRVM 80 
74314615   81 GKASFVTLQDVGGRIQLYVARDSLPEGVYNDQFKKWDLGDIIGARGTLFKTQTGELSIHCTELRLLTKALRPLPDKFHGL 160
152969073  81 GKASFVTLQDVGGRIQLYVARDDLPEGVYNEQFKKWDLGDIIAARGKLFKTQTGELSIHCTELRLLTKALRPLPDKFHGL 160
170682016  81 GKASFVTLQDVGGRIQLYVARDSLPEGVYNDQFKKWDLGDIIGARGTLFKTQTGELSIHCTELRLLTKALRPLPDKFHGL 160
206580188  81 GKASFVTLQDVGGRIQLYVARDDLPEGVYNEQFKKWDLGDIIAARGKLFKTQTGELSIHCTELRLLTKALRPLPDKFHGL 160
215489478  81 GKASFVTLQDVGGRIQLYVARDSLPEGVYNDQFKKWDLGDIIGARGTLFKTQTGALSIHCTELRLLTKALRPLPDKFHGL 160
218549238  81 GKASFVTLQDVGGRIQLYVARDSLPEGVYNDQFKKWDLGDIIGARGTLFKTQTGELSIHCTELRLLTKALRPLPDKFHGL 160
218561217  81 GKASFVTLQDVGGRIQLYVARDSLPEGVYNDQFKKWDLGDIIGARGTLFKTQTGELSIHCTELRLLTKALRPLPDKFHGL 160
218702794  81 GKASFVTLQDVGGRIQLYVARDSLPEGVYNDQFKKWDLGDIIGARGTLFKTQTGELSIHCTELRLLTKALRPLPDKFHGL 160
218707745  81 GKASFVTLQDVGGRIQLYVARDSLPEGVYNDQFKKWDLGDIIGARGTLFKTQTGELSIHCTELRLLTKALRPLPDKFHGL 160
238893514  81 GKASFVTLQDVGGRIQLYVARDDLPEGVYNEQFKKWDLGDIIAARGKLFKTQTGELSIHCTELRLLTKALRPLPDKFHGL 160
74314615  161 QDQEVRYRQRYLDLIANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVIPGGASARPFITHHNALDLDMYLRIAP 240
152969073 161 QDQEVRYRQRYLDLIANEESRHTFRIRSQILATMRQFMVARGFMEVETPMMQVIPGGASARPFITHHNALDLDMYLRIAP 240
170682016 161 QDQEVRYRQRYLDLIANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVIPGGASARPFITHHNALDLDMYLRIAP 240
206580188 161 QDQEVRYRQRYLDLIANEESRHTFRIRSQILATMRQFMVARGFMEVETPMMQVIPGGASARPFITHHNALDLDMYLRIAP 240
215489478 161 QDQEVRYRQRYLDLIANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVIPGGASARPFITHHNALDLDMYLRIAP 240
218549238 161 QDQEVRYRQRYLDLIANDKSRQTFVVRSKILAAIRKFMVARGFMEVETPMMQVIPGGASARPFITHHNALDLDMYLRIAP 240
218561217 161 QDQEVRYRQRYLDLIANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVIPGGASARPFITHHNALDLDMYLRIAP 240
218702794 161 QDQEVRYRQRYLDLIANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVIPGGASARPFITHHNALDLDMYLRIAP 240
218707745 161 QDQEVRYRQRYLDLIANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVIPGGASARPFITHHNALDLDMYLRIAP 240
238893514 161 QDQEVRYRQRYLDLIANEESRHTFRIRSQILATMRQFMVARGFMEVETPMMQVIPGGASARPFITHHNALDLDMYLRIAP 240
74314615  241 ELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYHDLIELTESLFRTLAQEVLGTTKVTYGEHVFDF 320
152969073 241 ELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESLFRTLAQTVLGKTEVPYGDQVFDF 320
170682016 241 ELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYHDLIELTESLFRTLAQEVLGTTKVTYGEHVFDF 320
206580188 241 ELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESLFRTLAQTVLGKTEVPYGDQVFDF 320
215489478 241 ELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYHDLIELTESLFRTLAQEVLGTTKVTYGEHVFDF 320
218549238 241 ELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYHDLIELTESLFRTLAQDVLGTTKVTYGEHVFDF 320
218561217 241 ELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYHDLIELTESLFRTLAQEVLGTTKVTYGEHVFDF 320
218702794 241 ELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYHDLIELTESLFRTLAQEVLGTTKVTYGEHVFDF 320
218707745 241 ELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYHDLIELTESLFRTLAQEVLGTTKVTYGEHVFDF 320
238893514 241 ELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESLFRTLAQTVLGKTEVPYGDQVFDF 320
74314615  321 GKPFEKLTMREAIKKYRPETDMADLDNFDAAKALAESIGITVEKSWGLGRIITEIFDEVAEAHLIQPTFITEYPAEVSPL 400
152969073 321 GKPFEKLTMREAIKKHRPETNMADLDNFDAAKALAESIGIQVEKSWGLGRIVTEIFDEVAEAHLIQPTFITEYPAEVSPL 400
170682016 321 GKPFEKLTMREAIKKYRPETDMADLDNFDAAKALAESIGITVEKSWGLGRIVTEIFDEVAEAHLIQPTFITEYPAEVSPL 400
206580188 321 GKPFEKLTMREAIKKHRPETNMADLDNFDAAKALAESLGIQVEKSWGLGRIVTEIFDEVAEAHLIQPTFITEYPAEVSPL 400
215489478 321 GKPFEKLTMREAIKKYRPETDMADLDNFDAAKALAESIGIMVEKSWGLGRIVTEIFDEVAEAHLIQPTFITEYPAEVSPL 400
218549238 321 GKPFEKLTMREAIKKYRPETDMADLDDFDAAKALAESIGITVEKSWGLGRIVTEIFDEVAEAHLIQPTFITEYPAEVSPL 400
218561217 321 GKPFEKLTMREAIKKYRPETDMADLDNFDAAKALAESIGITVEKSWGLGRIVTEIFDEVAEAHLIQPTFITEYPAEVSPL 400
218702794 321 GKPFEKLTMREAIKKYRPETDMADLDNFDAAKALAESIGITVEKSWGLGRIVTEIFDEVAEAHLIQPTFITEYPAEVSPL 400
218707745 321 GKPFEKLTMREAIKKYRPETDMADLDNFDAAKALAESIGITVEKSWGLGRIVTEIFDEVAEAHLIQPTFITEYPAEVSPL 400
238893514 321 GKPFEKLTMREAIKKHRPETNMADLDNFDAAKALAESIGIQVEKSWGLGRIVTEIFDEVAEAHLIQPTFITEYPAEVSPL 400
74314615  401 ARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAERFQEQVNAKAAGDDEAMFYDEDYVTALEYGLPPTAGLGIGID 480
152969073 401 ARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAQRFQDQVNAKAAGDDEAMFYDEDYVTALEYGLPPTAGLGIGID 480
170682016 401 ARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAERFQEQVNAKAAGDDEAMFYDEDYVTALEYGLPPTAGLGIGID 480
206580188 401 ARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAQRFQDQVNAKAAGDDEAMFYDEDYVTALEYGLPPTAGLGIGID 480
215489478 401 ARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAERFQEQVNAKAAGDDEAMFYDEDYVTALEYGLPPTAGLGIGID 480
218549238 401 ARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAERFQEQVNAKAAGDDEAMFYDEDYVTALEYGLPPTAGLGIGID 480
218561217 401 ARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAERFQEQVNAKAAGDDEAMFYDEDYVTALEYGLPPTAGLGIGID 480
218702794 401 ARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAERFQEQVNAKAAGDDEAMFYDEDYVTALEYGLPPTAGLGIGID 480
218707745 401 ARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAERFQEQVNAKAAGDDEAMFYDEDYVTALEYGLPPTAGLGIGID 480
238893514 401 ARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAQRFQDQVNAKAAGDDEAMFYDEDYVTALEYGLPPTAGLGIGID 480
74314615  481 RMIMLFTNSHTIRDVILFPAMRPQK 505
152969073 481 RMVMLFTNSHTIRDVILFPAMRPQK 505
170682016 481 RMIMLFTNSHTIRDVILFPAMRPQK 505
206580188 481 RMVMLFTNSHTIRDVILFPAMRPQK 505
215489478 481 RMIMLFTNSHTIRDVILFPAMRPQK 505
218549238 481 RMIMLFTNSHTIRDVILFPAMRPQK 505
218561217 481 RMIMLFTNSHTIRDVILFPAMRPQK 505
218702794 481 RMIMLFTNSHTIRDVILFPAMRPQK 505
218707745 481 RMIMLFTNSHTIRDVILFPAMRPQK 505
238893514 481 RMVMLFTNSHTIRDVILFPAMRPQK 505
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap