Conserved Protein Domain Family
PRK12439

?
PRK12439: PRK12439 
NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional
Statistics
?
PSSM-Id: 171500
View PSSM: PRK12439
Aligned: 24 rows
Threshold Bit Score: 542.453
Threshold Setting Gi: 226361522
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15607704    1 MAANKREPKVVVLGGGSWGTTVASICARRGPTLQWVRSAVTAQDINDNHRNSRYLGNDVVLSDTLRATTDFTEAANCADV 80 
119866842   1 MAHAQRQPKVVVLGGGSWGTTVASICSRRAPTIQWVRSEDTAKDINANHRNSRYLGEDVVLSESLRATTDFAEAASSADV 80 
118471985   1 MAASLRVPKVVVLGGGSWGTTVASICARRGPTLQWVRSEETAKDINENHRNSRYLGDDVVLPDSLTATNDFSEAAACADV 80 
120402010   1 MAPAQREPKVVVLGGGSWGTTVASICARRGPTLQWVRSAETAADINENHRNSKYLGDEVELAHTLRSTTDFTEAAECADV 80 
126433379   1 MAHAQRQPKVVVLGGGSWGTTVASICSRRAPTIQWVRSEDTAKDINANHRNSRYLGEDVVLSESLRATTDFAEAASSADV 80 
145225823   1 MAPAQREPKVVVLGGGSWGTTVASICARRGPTLQWVRSEETASDINDNHRNSKYLGDDVELAHTLKATTDFSEAAECADV 80 
169630994   1 -MAALREPQVVVLGGGSWGTTVASIVARRSPTLQWARSPETVADINERHRNSRYLSDEVELTESLRATSDLHEAVEQADV 79 
103485695   1 -----MRLKVGLLGGGSWGTTVAAVVSRNAPIQLWARDAETVEGINRDHENRKYLP-GITLPPALGATSDMAEVVAGADV 74 
111019387   1 ---MARPVRVVVLGAGSWGTTVAGLAAHNTPTLLWARNSDTADEINNEHRNSRYLG-DRPLPDSMRSTADLVEAAHEADV 76 
226361522   1 ---MARPVRVVVLGAGSWGTTVAGLAAHNTPTLLWARNSDTADEINSEHRNSRYLG-DRPLPDSMRSTADLVEAAQEADV 76 
15607704   81 VVMGVPSHGFRGVLVELSKELRPWVPVVSLVKGLEQGTNMRMSQIIEEVLPGHPAGILAGPNIAREVAEGYAAAAVLAMP 160
119866842  81 VVMGVPSHGFRGVLEKLAAELRPWVPVVSLVKGLEQGTNMRMSEIVDEVLPGHPAGILAGPNIAREVADGYAAAAVLAMP 160
118471985  81 IVMGVPSHGFRGVLQELARELRPWVPVVSLVKGLEQGTNLRMSQIVDEVLPGHPAGILAGPNIAREVAEGYAAAAVLAMP 160
120402010  81 IVMGVPSHGFRGVLTELAAHLRPWVPVVSLVKGLEQGTNYRMSQIVNEILPGHPAGILAGPNIAREVAEGYAAAAVLAMP 160
126433379  81 VVMGVPSHGFRGVLEKLAAELRPWVPVVSLVKGLEQGTNMRMSEIVDEVLPGHPAGILAGPNIAREVADGYAAAAVLAMP 160
145225823  81 IVMGVPSHGFRGVLTELAKELRPWVPVVSLVKGLEQGTNYRMSQIVDEVLPGHPAGILAGPNIAREVADGYAAAAVLAMP 160
169630994  80 VIMGVPSHSFREVLTEIGQSLRPWVPIVSLVKGLEQGSRMRMSQIIEEVLPGHPAGILAGPNIAKEVARGYAAAGVVAMP 159
103485695  75 LVMAVPSHSFRSVLEEARDHIRPWVPVISLTKGLELASGKRMTELIEDVLPGHPVGVLTGPNLAREIMAGQAAASVLSMA 154
111019387  77 LVVGVPSHAVRSTLAQIANEVRAWVPVLSLAKGLEPGTRLRPTEVIAECLPGHPVGLLAGPNIAREIVDGLAAASVVATQ 156
226361522  77 LVVGVPSHAVRSTLAQITNEVRAWVPVLSLAKGLEPGTRLRPTEVIAECLPGHPVGLLAGPNIAREIVDGLAAASVVATQ 156
15607704  161 DQHLATRLSAMFRTRRFRVYTTDDVVGVETAGALKNVFAIAVGMGYSLGIgentrALVIARALREMTKLGVAMGGKSETF 240
119866842 161 DQHLAAQLAELFRTKRFRTYTTDDVVGVEMAGALKNVYAIAVGMGYSLGIgentrAMVIARAVREMSKLGEAMGGHRDTF 240
118471985 161 DQHLAAKLAELFRTKRFRTYTTDDVTGVEMAGALKNVYAIAVGMGYSLGIgentrAMVMARAVREMAKLGEAAGGHRDTF 240
120402010 161 DQSLAANLAQLFRTKRFRTYTTDDVVGVEMAGALKNVYAIAVGMGYSLGIgentrAMVMARAVAEMSKLGVAMGGNRDTF 240
126433379 161 DQHLAAQLAELFRTKRFRTYTTDDVVGVEMAGALKNVYAIAVGMGYSLGIgentrAMVIARAVREMSKLGEAMGGHRDTF 240
145225823 161 DQHLAANLANLFRTKRFRTYTTDDVVGVEIAGALKNVYAIAVGMGYSLGIgentrAMVMARAVNEMSKMGVAMGGHRDTF 240
169630994 160 DQHQAARLGELFRTSRFRVYSTNDVVGVEMAGALKNVFAIASGMGYAIGIgentrAMVIARALREMTKLGVAMGGNPETF 239
103485695 155 DEIVVRALQPLFHSGLFRVYTNTDLLGCELGGVLKNIIAIAVGMGDGLGAgdntrAGLMTRGLAEITRLGVAMGGRPETF 234
111019387 157 DVRVATALQPLFASAVFRVYRNTDVLGCELGGVLKNIVAIASGMADGLDVgdntrAMVLARGLAEMTRLGEAMGANPRTF 236
226361522 157 DVRVATALQPLFASAVFRVYRNTDVLGCELGGVLKNIVAIASGMADGLDVgdntrAMVLARGLAEMTRLGEAMGANPRTF 236
15607704  241 PGLAGLGDLIVTCTSQRSRNRHVGEQLGAGKPIDEIIASMSQVAEGVKAAGVVMEFanefGLNMPIAREVDAVINHGSTV 320
119866842 241 AGLAGMGDLIVTCTSQRSRNRHVGEQLGSGKPIDEIIASMNQVAEGVKASKVIMEFadeyGLNMPIAREVDSVINHGSTV 320
118471985 241 AGLAGMGDLIVTCTSQRSRNRHVGEQLGAGKKIDEIIASMNQVAEGVKAASVIMEFadqyGLNMPIAREVDAVINHGSSV 320
120402010 241 AGLAGMGDLIVTCTSQRSRNRHVGEQLGQGKTVEEIIAAMNQVAEGVKAASVIMEFadkcGISMPIAREVDGVVNHGSTV 320
126433379 241 AGLAGMGDLIVTCTSQRSRNRHVGEQLGSGKPIDEIIASMNQVAEGVKASKVIMEFadeyGLNMPIAREVDSVINHGSTV 320
145225823 241 AGLAGMGDLIVTCTSQRSRNRHVGEQLGQGKTIEEIIAAMNQVAEGVKAASVIMEFaekyGISMPIAREVDGVVNHGSTV 320
169630994 240 PGLAGLGDLIVTCTSSSSRNRHVGEEIGKGKTIDEIITSMNQVAEGVKASSVVMTLadeyGIQMPIAREVDGVINQGSTV 319
103485695 235 AGLTGMGDLIATCTSPLSRNRHVGVELGKGRPIDAIIAGMNMVAEGVKSAPTVMALadrhGIAMPIARDVFDVTQGKRTA 314
111019387 237 AGLTGVGDLIATCMSPSSRNRRVGEYIARGMTVDEAVAKLGQVAEGVKTAPTVMELardyNVEMPIAAEVEAVVAGRQTP 316
226361522 237 AGLTGVGDLIATCMSPSSRNRRVGEFIARGMTVEEAVAKLGQVAEGVKTAPTVMELardyNVDMPIAAEVEAVVAGRQTP 316
15607704  321 EQAYRGLIAEVPGHEVHGSGF 341
119866842 321 EQAYRGLVAEKPGHEVYGSGF 341
118471985 321 EQAYRGLMAEKTGHEVHSSGF 341
120402010 321 EQAYRGLVAEKPGHEVHGSGF 341
126433379 321 EQAYRGLVAEKPGHEVYGSGF 341
145225823 321 EQAYHGLVAEKPGHEVHGSGF 341
169630994 320 EQAYRGLMAETPGHEVHGTGF 340
103485695 315 MDVFRGLLKSSVGDEAHPG-- 333
111019387 317 EGAYRGLRKVAAGGEHEVA-- 335
226361522 317 EGAYRGLRKVAAGGEHEVA-- 335
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap